LOCUS       NM_022363               2084 bp    mRNA    linear   PRI 18-APR-2013
DEFINITION  Homo sapiens LIM homeobox 5 (LHX5), mRNA.
ACCESSION   NM_022363
VERSION     NM_022363.2  GI:30795197
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2084)
  AUTHORS   Green,E.K., Elvidge,G.P., Owen,M.J. and Craddock,N.
  TITLE     Mutational analysis of two positional candidate susceptibility
            genes for bipolar disorder on chromosome 12q23-q24: phenylalanine
            hydroxylase and human LIM-homeobox LHX5
  JOURNAL   Psychiatr. Genet. 13 (2), 97-101 (2003)
   PUBMED   12782966
  REMARK    GeneRIF: Variation is not a highly penetrant autosomal dominant
            susceptibility locus for mood disorder in families.
REFERENCE   2  (bases 1 to 2084)
  AUTHORS   Paylor,R., Zhao,Y., Libbey,M., Westphal,H. and Crawley,J.N.
  TITLE     Learning impairments and motor dysfunctions in adult Lhx5-deficient
            mice displaying hippocampal disorganization
  JOURNAL   Physiol. Behav. 73 (5), 781-792 (2001)
   PUBMED   11566211
  REMARK    GeneRIF: In mice, this protein is involved in learning and motor
            functions.
REFERENCE   3  (bases 1 to 2084)
  AUTHORS   Zhao,Y., Hermesz,E., Yarolin,M.C. and Westphal,H.
  TITLE     Genomic structure, chromosomal localization and expression of the
            human LIM-homeobox gene LHX5
  JOURNAL   Gene 260 (1-2), 95-101 (2000)
   PUBMED   11137295
REFERENCE   4  (bases 1 to 2084)
  AUTHORS   Zhao,Y., Sheng,H.Z., Amini,R., Grinberg,A., Lee,E., Huang,S.,
            Taira,M. and Westphal,H.
  TITLE     Control of hippocampal morphogenesis and neuronal differentiation
            by the LIM homeobox gene Lhx5
  JOURNAL   Science 284 (5417), 1155-1158 (1999)
   PUBMED   10325223
  REMARK    GeneRIF: In mice, this protein is essential for the regulation of
            precursor cell proliferation and the control of neuronal
            differentiation and migration during hippocampal development.
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AF291181.1.
            On May 16, 2003 this sequence version replaced gi:11641282.
            
            Summary: This gene encodes a protein belonging to a large protein
            family, members of which carry the LIM domain, a unique
            cysteine-rich zinc-binding domain. The encoded protein may function
            as a transcriptional regulator and be involved in the control of
            differentiation and development of the forebrain. In mice, this
            protein is essential for the regulation of precursor cell
            proliferation and the control of neuronal differentiation and
            migration during hippocampal development. This protein is involved
            in learning and motor functions in adult mice. [provided by RefSeq,
            Jul 2008].
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF291181.1, BC109230.2 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..2084
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="12"
                     /map="12q24"
     gene            1..2084
                     /gene="LHX5"
                     /note="LIM homeobox 5"
                     /db_xref="GeneID:64211"
                     /db_xref="HGNC:14216"
                     /db_xref="HPRD:09344"
                     /db_xref="MIM:605992"
     exon            1..747
                     /gene="LHX5"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(41)
                     /gene="LHX5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:75436375"
     variation       complement(57)
                     /gene="LHX5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375856568"
     variation       complement(239..240)
                     /gene="LHX5"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:34968619"
     variation       complement(239)
                     /gene="LHX5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185371881"
     variation       complement(263)
                     /gene="LHX5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11609339"
     variation       complement(313)
                     /gene="LHX5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112078658"
     variation       complement(334)
                     /gene="LHX5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145928738"
     misc_feature    440..442
                     /gene="LHX5"
                     /note="upstream in-frame stop codon"
     variation       complement(472)
                     /gene="LHX5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:61459887"
     variation       complement(501)
                     /gene="LHX5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138125505"
     STS             531..2010
                     /gene="LHX5"
                     /db_xref="UniSTS:484042"
     variation       complement(549)
                     /gene="LHX5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:145484604"
     variation       complement(574)
                     /gene="LHX5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369375356"
     CDS             575..1783
                     /gene="LHX5"
                     /note="LIM homeobox protein 5"
                     /codon_start=1
                     /product="LIM/homeobox protein Lhx5"
                     /protein_id="NP_071758.1"
                     /db_xref="GI:11641283"
                     /db_xref="CCDS:CCDS9171.1"
                     /db_xref="GeneID:64211"
                     /db_xref="HGNC:14216"
                     /db_xref="HPRD:09344"
                     /db_xref="MIM:605992"
                     /translation="

MMVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYLSSSSLKEGSLNSVSSCTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYAPGSNYDFFAHGPPSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHAADNPRFTDMISHPDTPSPEPGLPGTLHPMPGEVFSGGPSPPFPMSGTSGYSGPLSHPNPELNEAAVW

"
     misc_feature    587..742
                     /gene="LHX5"
                     /note="The first LIM domain of Lhx1 (also known as Lim1)
                     and Lhx5; Region: LIM1_Lhx1_Lhx5; cd09367"
                     /db_xref="CDD:188753"
     misc_feature    order(587..589,596..598,650..652,659..661,668..670,
                     677..679,728..730,737..739)
                     /gene="LHX5"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188753"
     misc_feature    764..931
                     /gene="LHX5"
                     /note="The second LIM domain of Lhx1 (also known as Lim1)
                     and Lhx5; Region: LIM2_Lhx1_Lhx5; cd09375"
                     /db_xref="CDD:188761"
     misc_feature    order(764..766,773..775,830..832,839..841,848..850,
                     857..859,917..919,926..928)
                     /gene="LHX5"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188761"
     misc_feature    1115..1291
                     /gene="LHX5"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(1115..1129,1133..1135,1184..1186,1202..1204,
                     1241..1243,1247..1252,1259..1264,1268..1276,1280..1285)
                     /gene="LHX5"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(1121..1123,1130..1132,1250..1252,1259..1264,
                     1271..1273)
                     /gene="LHX5"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     variation       complement(603)
                     /gene="LHX5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:187043986"
     variation       complement(646)
                     /gene="LHX5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369227581"
     variation       complement(694)
                     /gene="LHX5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142448695"
     variation       complement(700)
                     /gene="LHX5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200962824"
     variation       complement(703)
                     /gene="LHX5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201815436"
     variation       complement(715)
                     /gene="LHX5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200072402"
     exon            748..971
                     /gene="LHX5"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(749)
                     /gene="LHX5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202027707"
     variation       complement(760)
                     /gene="LHX5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200914993"
     variation       complement(784)
                     /gene="LHX5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373639469"
     variation       complement(797)
                     /gene="LHX5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148774477"
     variation       complement(826)
                     /gene="LHX5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201387217"
     variation       complement(871)
                     /gene="LHX5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373513780"
     variation       complement(877)
                     /gene="LHX5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374968201"
     variation       complement(880)
                     /gene="LHX5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113201786"
     variation       complement(892)
                     /gene="LHX5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370003825"
     variation       complement(901)
                     /gene="LHX5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377541276"
     exon            972..1249
                     /gene="LHX5"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1019)
                     /gene="LHX5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200149314"
     variation       complement(1041)
                     /gene="LHX5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139906449"
     variation       complement(1060)
                     /gene="LHX5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150010110"
     variation       complement(1174)
                     /gene="LHX5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111226838"
     variation       complement(1201)
                     /gene="LHX5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147482889"
     exon            1250..1415
                     /gene="LHX5"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1267)
                     /gene="LHX5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:143030604"
     variation       complement(1307)
                     /gene="LHX5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12813507"
     variation       complement(1328)
                     /gene="LHX5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140697498"
     variation       complement(1349)
                     /gene="LHX5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374001717"
     exon            1416..2084
                     /gene="LHX5"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1417)
                     /gene="LHX5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200440378"
     variation       complement(1462)
                     /gene="LHX5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:376231895"
     variation       complement(1468)
                     /gene="LHX5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373410781"
     variation       complement(1546)
                     /gene="LHX5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202131487"
     variation       complement(1664)
                     /gene="LHX5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187656376"
     variation       complement(1685)
                     /gene="LHX5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113202219"
     variation       complement(1898)
                     /gene="LHX5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140791986"
     variation       complement(1926)
                     /gene="LHX5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12319643"
     variation       complement(1950)
                     /gene="LHX5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182980779"
     variation       complement(1955..1956)
                     /gene="LHX5"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:373327914"
     variation       complement(1955)
                     /gene="LHX5"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:35666719"
ORIGIN      

aaccaggtacaagctaatactcaacaatactgatgccttgttttttttgctctgtccggacagcaacgctgtagccaatttagatatgctataaatttaagaggttgccatggccacggtgcgcccattggccgctgggccccctacgtgcagcgccacgtcaccaaatctgaataaggatgcgcgaattacgcggcgaccagacaaagatgaggatccggaccgcttgaaagtgggggaaagtgccggcgcctccgccaccggggaaagccgctccgcagcgccgaggccagcagccacccgagatacctggggaagcccggaacaggcgccggggcgtgcggcccgtggcatgaggttgtgaacgccacccgccccccaccaccccactccgggcagcccagcgccaggccagagattgcccaaggactggaccggctgagtcttggtccggaccagactcgccctgcagctgctgagacaagaggcgaagggcagcggagggcccggcaggcccgagggccaggggcccaaagggagggcaaggcggccgaagccgccggggcgcggggctatgatggtgcactgcgccggttgcgagcggcccatcctcgaccgctttctgctgaacgtgctggaccgcgcgtggcacatcaaatgtgttcagtgctgcgagtgcaaaaccaacctctcggagaagtgcttctcgcgcgagggcaagctctactgcaaaaatgactttttcaggcgctttggcacgaaatgcgccggctgcgcgcaaggcatctcgcccagcgacctggtgcgcaaggcccggagcaaagtctttcacctcaactgtttcacctgcatggtgtgtaacaagcagctgtccaccggcgaggagctctacgtcatcgacgagaacaagttcgtgtgcaaagacgactacctgagctcatccagcctcaaggagggcagcctcaactcagtgtcatcctgtacggaccgcagtttgtccccggacctccaggacgcactgcaggacgaccccaaagagacggacaactcgacctcgtcggacaaggagacggccaacaacgagaacgaggagcagaactcgggcaccaagcggcgcggcccccgcaccaccatcaaggccaagcagctggagacgctcaaggctgccttcgccgccacgcccaagcccacgcgccacatccgcgagcagctggcgcaggagaccggcctcaacatgcgcgtcatccaggtgtggtttcagaaccgacggtccaaagaacgccggatgaaacagctgagcgccctaggcgcccggaggcacgccttcttccggagtccgcggcgcatgcgtccgctgggcggccgcttggacgagtctgagatgttggggtccaccccgtacacctactacggagactaccaaggcgactactacgcgccgggaagcaactacgacttcttcgcgcacggcccgccttcgcaggcgcagtccccggccgactccagcttcctggcggcctctggccccggctcgacgccgctgggagcgctggaaccgccgctcgccggcccgcacgccgcggacaaccccaggttcaccgacatgatctcgcacccggacacaccgagccccgagccaggcctgccgggcacgctgcaccccatgcccggcgaggtattcagcggcgggcccagcccgcccttcccaatgagcggcaccagcggctacagcggacccctgtcgcatcccaaccccgagctcaacgaagccgccgtgtggtaaggccgccgggccgccccccgcgctcggcccccgggggccccgccccgaagcagcctcctgaaaccaaaacgcccgacgcagacgcggtgggagacgtgggtgtccctcgggggttctctctcgggtccgcactcaactggcagctgctcctcggctgggcgccgagggggggccgacccccatctccaccccgcgggctctccaggagcctcagcccaccgccagtactctcccagcaaccgcgagcaatttcttgggaccaaagtcaatactccggagggtcaagagatttcgagcacgc

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:64211 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:64211 -> Molecular function: GO:0008270 [zinc ion binding] evidence: IEA
            GeneID:64211 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:64211 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
            GeneID:64211 -> Biological process: GO:0021527 [spinal cord association neuron differentiation] evidence: IEA
            GeneID:64211 -> Biological process: GO:0021702 [cerebellar Purkinje cell differentiation] evidence: IEA
            GeneID:64211 -> Biological process: GO:0021766 [hippocampus development] evidence: IEA
            GeneID:64211 -> Biological process: GO:0021846 [cell proliferation in forebrain] evidence: IEA
            GeneID:64211 -> Biological process: GO:0021879 [forebrain neuron differentiation] evidence: IEA
            GeneID:64211 -> Biological process: GO:0021937 [cerebellar Purkinje cell-granule cell precursor cell signaling involved in regulation of granule cell precursor cell proliferation] evidence: IEA
            GeneID:64211 -> Biological process: GO:0045893 [positive regulation of transcription, DNA-dependent] evidence: IEA
            GeneID:64211 -> Cellular component: GO:0005634 [nucleus] evidence: IEA