Home |
Help |
Advanced search
2024-04-25 20:22:20, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_020368 2088 bp mRNA linear PRI 24-MAR-2013
DEFINITION Homo sapiens UTP3, small subunit (SSU) processome component,
homolog (S. cerevisiae) (UTP3), mRNA.
ACCESSION NM_020368
VERSION NM_020368.2 GI:209977043
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2088)
AUTHORS Park,S.K., Son,Y. and Kang,C.J.
TITLE A strong promoter activity of pre-B cell stage-specific Crlz1 gene
is caused by one distal LEF-1 and multiple proximal Ets sites
JOURNAL Mol. Cells 32 (1), 67-76 (2011)
PUBMED 21544627
REMARK GeneRIF: A strong promoter activity of pre-B cell stage-specific
Crlz1 gene is caused by one distal LEF-1 and multiple proximal Ets
sites.
REFERENCE 2 (bases 1 to 2088)
AUTHORS Lim,J.H., Cho,S.J., Park,S.K., Kim,J., Cho,D., Lee,W.J. and
Kang,C.J.
TITLE Stage-specific expression of two neighboring Crlz1 and IgJ genes
during B cell development is regulated by their chromatin
accessibility and histone acetylation
JOURNAL J. Immunol. 177 (8), 5420-5429 (2006)
PUBMED 17015728
REFERENCE 3 (bases 1 to 2088)
AUTHORS Nousiainen,M., Sillje,H.H., Sauer,G., Nigg,E.A. and Korner,R.
TITLE Phosphoproteome analysis of the human mitotic spindle
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 103 (14), 5391-5396 (2006)
PUBMED 16565220
REFERENCE 4 (bases 1 to 2088)
AUTHORS Stelzl,U., Worm,U., Lalowski,M., Haenig,C., Brembeck,F.H.,
Goehler,H., Stroedicke,M., Zenkner,M., Schoenherr,A., Koeppen,S.,
Timm,J., Mintzlaff,S., Abraham,C., Bock,N., Kietzmann,S.,
Goedde,A., Toksoz,E., Droege,A., Krobitsch,S., Korn,B.,
Birchmeier,W., Lehrach,H. and Wanker,E.E.
TITLE A human protein-protein interaction network: a resource for
annotating the proteome
JOURNAL Cell 122 (6), 957-968 (2005)
PUBMED 16169070
REFERENCE 5 (bases 1 to 2088)
AUTHORS Andersen,J.S., Lam,Y.W., Leung,A.K., Ong,S.E., Lyon,C.E.,
Lamond,A.I. and Mann,M.
TITLE Nucleolar proteome dynamics
JOURNAL Nature 433 (7021), 77-83 (2005)
PUBMED 15635413
REFERENCE 6 (bases 1 to 2088)
AUTHORS Andersen,J.S., Lyon,C.E., Fox,A.H., Leung,A.K., Lam,Y.W., Steen,H.,
Mann,M. and Lamond,A.I.
TITLE Directed proteomic analysis of the human nucleolus
JOURNAL Curr. Biol. 12 (1), 1-11 (2002)
PUBMED 11790298
REFERENCE 7 (bases 1 to 2088)
AUTHORS Simpson,J.C., Wellenreuther,R., Poustka,A., Pepperkok,R. and
Wiemann,S.
TITLE Systematic subcellular localization of novel proteins identified by
large-scale cDNA sequencing
JOURNAL EMBO Rep. 1 (3), 287-292 (2000)
PUBMED 11256614
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
DB021011.1 and AK026909.1.
On Oct 28, 2008 this sequence version replaced gi:9966798.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-52 DB021011.1 1-52
53-2088 AK026909.1 2-2037
FEATURES Location/Qualifiers
source 1..2088
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="4"
/map="4q13.3"
gene 1..2088
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/note="UTP3, small subunit (SSU) processome component,
homolog (S. cerevisiae)"
/db_xref="GeneID:57050"
/db_xref="HGNC:24477"
/db_xref="HPRD:18016"
/db_xref="MIM:611614"
exon 1..2073
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/inference="alignment:Splign:1.39.8"
variation 34
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="g"
/db_xref="dbSNP:368973346"
variation 51
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="g"
/replace="t"
/db_xref="dbSNP:17735360"
variation 55
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:113215267"
variation 80
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:3733488"
variation 183..184
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace=""
/replace="a"
/db_xref="dbSNP:34165830"
misc_feature 194..196
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/note="upstream in-frame stop codon"
CDS 200..1639
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/note="charged amino acid rich leucine zipper 1 homolog;
disrupter of silencing 10; UTP3 homolog; disrupter of
silencing SAS10; charged amino acid-rich leucine zipper 1"
/codon_start=1
/product="something about silencing protein 10"
/protein_id="NP_065101.1"
/db_xref="GI:9966799"
/db_xref="CCDS:CCDS3546.1"
/db_xref="GeneID:57050"
/db_xref="HGNC:24477"
/db_xref="HPRD:18016"
/db_xref="MIM:611614"
/translation="
MVGRSRRRGAAKWAAVRAKAGPTLTDENGDDLGLPPSPGDTSYYQDQVDDFHEARSRAALAKGWNEVQSGDEEDGEEEEEEVLALDMDDEDDEDGGNAGEEEEEENADDDGGSSVQSEAEASVDPSLSWGQRKKLYYDTDYGSKSRGRQSQQEAEEEEREEEEEAQIIQRRLAQALQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQYLRTKYNLYLNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPKPKSVSKTSAAACAVTDLSDDSDFDEKAKLKYYKEIEDRQKLKRKKEENSTEEQALEDQNAKRAITYQIAKNRGLTPRRKKIDRNPRVKHREKFRRAKIRRRGQVREVRKEEQRYSGELSGIRAGVKKSIKLK
"
misc_feature 308..310
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q9NQZ2.1); phosphorylation site"
misc_feature 308..310
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 647..649
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q9NQZ2.1); phosphorylation site"
misc_feature 647..649
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 884..1129
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/note="Sas10/Utp3/C1D family; Region: Sas10_Utp3;
pfam04000"
/db_xref="CDD:202850"
misc_feature 1283..1285
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine; propagated from
UniProtKB/Swiss-Prot (Q9NQZ2.1); phosphorylation site"
misc_feature 1292..1294
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q9NQZ2.1); phosphorylation site"
misc_feature 1292..1294
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 1301..1303
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q9NQZ2.1); phosphorylation site"
misc_feature 1301..1303
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 1406..1633
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/note="Sas10 C-terminal domain; Region: Sas10_Utp3_C;
pfam09368"
/db_xref="CDD:204214"
variation 261
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:200884643"
variation 267
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="t"
/db_xref="dbSNP:16845385"
variation 268
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:143293658"
variation 283
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="t"
/db_xref="dbSNP:16845387"
variation 334
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:141991251"
variation 352
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="t"
/db_xref="dbSNP:138153717"
variation 379
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="t"
/db_xref="dbSNP:185831561"
variation 388
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="t"
/db_xref="dbSNP:142687496"
variation 415
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:371426695"
variation 426..428
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace=""
/replace="agg"
/db_xref="dbSNP:369776055"
variation 452
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="t"
/db_xref="dbSNP:150580368"
variation 476
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="g"
/db_xref="dbSNP:375905342"
variation 496..498
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace=""
/replace="gga"
/db_xref="dbSNP:146575538"
variation 506..508
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace=""
/replace="gag"
/db_xref="dbSNP:72049616"
variation 512..514
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace=""
/replace="gag"
/db_xref="dbSNP:61104402"
variation 514
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="g"
/replace="t"
/db_xref="dbSNP:139575168"
variation 515
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:199884760"
variation 538
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="c"
/db_xref="dbSNP:199724861"
variation 540
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="t"
/db_xref="dbSNP:369756713"
variation 559
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:149285635"
variation 565
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="t"
/db_xref="dbSNP:144519797"
variation 566
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="g"
/db_xref="dbSNP:139549167"
variation 643
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:376391430"
variation 657
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="c"
/db_xref="dbSNP:201931730"
variation 659
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="g"
/replace="t"
/db_xref="dbSNP:145063393"
variation 670
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:185662183"
variation 674..675
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace=""
/replace="gag"
/db_xref="dbSNP:373643759"
variation 675
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:75530615"
variation 682
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:373204587"
variation 714
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="g"
/replace="t"
/db_xref="dbSNP:140266757"
variation 769
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:142982822"
variation 779
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="t"
/db_xref="dbSNP:111485612"
variation 804
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:199913762"
variation 814
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:201070267"
variation 858
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:190818739"
variation 917
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:141044445"
variation 921
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:150243800"
variation 939
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="t"
/db_xref="dbSNP:141537804"
variation 1069
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="c"
/db_xref="dbSNP:146828085"
variation 1078
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="t"
/db_xref="dbSNP:370336880"
variation 1132
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="g"
/db_xref="dbSNP:11541969"
variation 1156
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="c"
/db_xref="dbSNP:182866939"
variation 1166
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="t"
/db_xref="dbSNP:150475938"
variation 1176
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="t"
/db_xref="dbSNP:376104894"
variation 1228
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="t"
/db_xref="dbSNP:140595291"
variation 1303
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="t"
/db_xref="dbSNP:145677997"
variation 1312
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="t"
/db_xref="dbSNP:34648105"
variation 1362
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="t"
/db_xref="dbSNP:373036425"
variation 1378
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="c"
/db_xref="dbSNP:142723624"
variation 1400
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:200408107"
variation 1403
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="c"
/db_xref="dbSNP:143187619"
variation 1428
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="t"
/db_xref="dbSNP:149552771"
variation 1430
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:376767606"
variation 1461
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="g"
/replace="t"
/db_xref="dbSNP:111975570"
variation 1488
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:202010379"
variation 1504
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:150767394"
variation 1554
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:140047180"
variation 1563
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:370936337"
variation 1604
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="t"
/db_xref="dbSNP:375718549"
variation 1641
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:367902966"
variation 1648
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="t"
/db_xref="dbSNP:377141669"
STS 1656..1812
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/standard_name="SHGC-56824"
/db_xref="UniSTS:47185"
variation 1697
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:77013514"
variation 1762
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="g"
/replace="t"
/db_xref="dbSNP:16845388"
variation 1766
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="c"
/replace="g"
/db_xref="dbSNP:16845390"
STS 1793..1912
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/standard_name="SHGC-67668"
/db_xref="UniSTS:2588"
variation 1944
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="g"
/db_xref="dbSNP:187936171"
variation 1958..1959
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace=""
/replace="g"
/db_xref="dbSNP:35275699"
variation 1987
/gene="UTP3"
/gene_synonym="CRL1; CRLZ1; SAS10"
/replace="a"
/replace="c"
/db_xref="dbSNP:111479149"
ORIGIN
aatcgtacgccacgcggagagcatgctgggggccggaaggaagaggaaattccagtagccgatcaggagtctgcaaactccggtggtaggggagcgcgctgctgtttagagccacgagttaccggagcgcctgattcctgcgccgaagtcagtggtggccgaaagtccggagtcgctgtaaaacctgagattgtgagccatggtggggagatcccggcggcgcggagcagctaagtgggcagctgtgcgagccaaggcaggtcccacgctcaccgacgaaaatggagatgatttaggattgccaccctcaccaggggacaccagctactaccaagatcaggtagatgactttcatgaggcacgatcccgggccgccttagctaagggctggaatgaagtacagagtggagacgaggaggatggcgaggaggaggaggaggaggtgctagccctagatatggacgatgaggacgacgaagatggagggaatgcgggggaggaggaggaggaggagaatgccgatgatgatggtgggagctccgtgcaaagtgaagctgaggcctctgtggatcccagtttgtcgtggggtcagaggaaaaaactttactatgacacggactatggttccaagtcccgaggccggcagagtcaacaggaggcagaggaggaggaaagagaggaggaggaggaggcacagatcattcagcggcgcctagcccaagcgctgcaagaggatgattttggtgtcgcctgggttgaggcctttgcaaaaccagtgcctcaggtagatgaggctgagacacgggtcgtgaaggatttggctaaagtttcagtgaaagagaagctgaaaatgttgcgaaaggaatcaccagaactcttggagctgatagaagacctgaaagtcaagttgacagaggttaaggatgagctggagccattgttagagttggtggaacaagggatcattccacccggaaaaggaagccaatacttgaggaccaagtacaacctctacttgaattattgctcgaacatcagtttttatttgatcctgaaagctaggagagtcccagcacatggacatcctgtcatagaaaggcttgttacctaccgaaatttgatcaacaagctgtccgttgtggatcagaagctgtcctcagaaattcgtcatctgttgacacttaaggatgatgctgtaaagaaagaactgattccaaaagcaaaatccaccaagcccaaaccaaagtctgtttcaaagacttctgctgctgcctgtgctgttacagatctttctgatgattctgattttgatgaaaaagcaaaactgaagtactataaagaaatagaagacaggcaaaagctaaagagaaagaaagaagaaaatagcactgaagaacaggctcttgaagatcaaaatgcaaagagagctattacctatcaaattgctaaaaataggggacttactcctaggagaaagaagattgatcgcaatcccagagtgaaacacagagagaagttcagaagagccaaaattagaagaagaggccaggttcgtgaagttcgtaaagaagagcaacgttatagtggtgaattatctggcattcgtgcaggagttaaaaagagcattaagcttaaatgaagtttttgcttagcataaggtttttggcagttttggatcaataaatttttacttttaactaaagtcattgtattaatatataatactttaaattttaaaaattcttgtccacaaggaaatttgtctgggttattggacaatttataagaactatgggagcaatatgaaggtgcttgagaaaagagatgatgttgaagttttccaatattctgttgaagttttccaatattaagtattagcttagggaaatttcacagttcattgtggagtgttaaacttagaacatgtgtaacttttcacataaagagaatgcatctttgacagttatcttatttgtaaggcagcctataaaatagttctgaagtattttatttacctaactataattattgggccagatacttgttaataaatgggcttaatgttaacatggaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:57050 -> Molecular function: GO:0003674 [molecular_function] evidence: ND
GeneID:57050 -> Biological process: GO:0007420 [brain development] evidence: ISS
GeneID:57050 -> Biological process: GO:0016568 [chromatin modification] evidence: IEA
GeneID:57050 -> Cellular component: GO:0005634 [nucleus] evidence: ISS
GeneID:57050 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.