Home |
Help |
Advanced search
2024-04-20 07:56:16, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_019884 2200 bp mRNA linear PRI 19-MAY-2013
DEFINITION Homo sapiens glycogen synthase kinase 3 alpha (GSK3A), mRNA.
ACCESSION NM_019884
VERSION NM_019884.2 GI:49574531
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2200)
AUTHORS Rahmani,M., Aust,M.M., Attkisson,E., Williams,D.C. Jr.,
Ferreira-Gonzalez,A. and Grant,S.
TITLE Dual inhibition of Bcl-2 and Bcl-xL strikingly enhances PI3K
inhibition-induced apoptosis in human myeloid leukemia cells
through a GSK3- and Bim-dependent mechanism
JOURNAL Cancer Res. 73 (4), 1340-1351 (2013)
PUBMED 23243017
REMARK GeneRIF: Findings suggest that inhibiton of Bcl-2, Bcl-xL and PI3K,
and release of Bim from Bcl-2/Bcl-xL and GSK3alpha/beta culminating
in Bax/Bak activation and apoptosis.
REFERENCE 2 (bases 1 to 2200)
AUTHORS Linke,R., Pries,R., Konnecke,M., Bruchhage,K.L., Boscke,R.,
Gebhard,M. and Wollenberg,B.
TITLE Glycogen synthase kinase 3 in chronic rhinosinusitis: two faces of
a single enzyme in one disease
JOURNAL Ann. Allergy Asthma Immunol. 110 (2), 101-106 (2013)
PUBMED 23352529
REMARK GeneRIF: GSK-3 may play a crucial role in the inflammatory process
in chronic rhinosinusitis with nasal polyps (CRSwNP).
REFERENCE 3 (bases 1 to 2200)
AUTHORS Mammano,E., Galdi,F., Pierobon,M., Tessari,E., Deng,J.,
Pucciarelli,S., Agostini,M., De Marchi,F., Canzonieri,V., De
Paoli,A., Belluco,C., Liotta,L., Petricoin,E., Pilati,P. and
Nitti,D.
TITLE Multiplexed protein signal pathway mapping identifies patients with
rectal cancer that responds to neoadjuvant treatment
JOURNAL Clin Colorectal Cancer 11 (4), 268-274 (2012)
PUBMED 22658458
REMARK GeneRIF: Lower phosphorylation levels of GSK3A is associated with
poor treatment response in rectal cancer.
REFERENCE 4 (bases 1 to 2200)
AUTHORS Lin,S.Y., Li,T.Y., Liu,Q., Zhang,C., Li,X., Chen,Y., Zhang,S.M.,
Lian,G., Liu,Q., Ruan,K., Wang,Z., Zhang,C.S., Chien,K.Y., Wu,J.,
Li,Q., Han,J. and Lin,S.C.
TITLE GSK3-TIP60-ULK1 signaling pathway links growth factor deprivation
to autophagy
JOURNAL Science 336 (6080), 477-481 (2012)
PUBMED 22539723
REMARK GeneRIF: glycogen synthase kinase-3 (GSK3), when deinhibited by
default in cells deprived of growth factors, activates
acetyltransferase TIP60 through phosphorylating TIP60-Ser86, which
acetylates and stimulates the protein kinase ULK1, which is
required for autophagy
Erratum:[Science. 2012 Aug 17;337(6096):799]
REFERENCE 5 (bases 1 to 2200)
AUTHORS Lu,F.F., Su,P., Liu,F. and Daskalakis,Z.J.
TITLE Activation of GABA(B) receptors inhibits protein kinase B/glycogen
synthase kinase 3 signaling
JOURNAL Mol Brain 5, 41 (2012)
PUBMED 23192081
REMARK GeneRIF: Activation of GABA(B) receptors significantly inhibits
Akt/GSK-3 signaling in a beta-arrestin-dependent pathway.
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 2200)
AUTHORS Shaw,P.C., Davies,A.F., Lau,K.F., Garcia-Barcelo,M., Waye,M.M.,
Lovestone,S., Miller,C.C. and Anderton,B.H.
TITLE Isolation and chromosomal mapping of human glycogen synthase
kinase-3 alpha and -3 beta encoding genes
JOURNAL Genome 41 (5), 720-727 (1998)
PUBMED 9809441
REFERENCE 7 (bases 1 to 2200)
AUTHORS Harr,S.D., Hollister,R.D. and Hyman,B.T.
TITLE Glycogen synthase kinase 3 alpha and 3 beta do not colocalize with
neurofibrillary tangles
JOURNAL Neurobiol. Aging 17 (3), 343-348 (1996)
PUBMED 8725894
REFERENCE 8 (bases 1 to 2200)
AUTHORS Cross,D.A., Alessi,D.R., Cohen,P., Andjelkovich,M. and
Hemmings,B.A.
TITLE Inhibition of glycogen synthase kinase-3 by insulin mediated by
protein kinase B
JOURNAL Nature 378 (6559), 785-789 (1995)
PUBMED 8524413
REFERENCE 9 (bases 1 to 2200)
AUTHORS He,X., Saint-Jeannet,J.P., Woodgett,J.R., Varmus,H.E. and
Dawid,I.B.
TITLE Glycogen synthase kinase-3 and dorsoventral patterning in Xenopus
embryos
JOURNAL Nature 374 (6523), 617-622 (1995)
PUBMED 7715701
REMARK Erratum:[Nature 1995 May 18;375(6528):253]
REFERENCE 10 (bases 1 to 2200)
AUTHORS Yang,S.D., Yu,J.S., Shiah,S.G. and Huang,J.J.
TITLE Protein kinase FA/glycogen synthase kinase-3 alpha after heparin
potentiation phosphorylates tau on sites abnormally phosphorylated
in Alzheimer's disease brain
JOURNAL J. Neurochem. 63 (4), 1416-1425 (1994)
PUBMED 7931292
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BC027984.1, L40027.1, D63424.1 and BC051865.2.
On Jul 1, 2004 this sequence version replaced gi:11995473.
Summary: This gene encodes a multifunctional Ser/Thr protein kinase
that is implicated in the control of several regulatory proteins
including glycogen synthase, and transcription factors, such as
JUN. It also plays a role in the WNT and PI3K signaling pathways,
as well as regulates the production of beta-amyloid peptides
associated with Alzheimer's disease. [provided by RefSeq, Oct
2011].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC051865.2, BC027984.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025081, ERS025082 [ECO:0000350]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-1438 BC027984.1 20-1457
1439-1440 L40027.1 1434-1435
1441-2182 D63424.1 1413-2154
2183-2189 BC027984.1 2202-2208
2190-2200 BC051865.2 2179-2189
FEATURES Location/Qualifiers
source 1..2200
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="19"
/map="19q13.2"
gene 1..2200
/gene="GSK3A"
/note="glycogen synthase kinase 3 alpha"
/db_xref="GeneID:2931"
/db_xref="HGNC:4616"
/db_xref="MIM:606784"
exon 1..402
/gene="GSK3A"
/inference="alignment:Splign:1.39.8"
CDS 120..1571
/gene="GSK3A"
/EC_number="2.7.11.1"
/EC_number="2.7.11.26"
/note="GSK-3 alpha; serine/threonine-protein kinase GSK3A"
/codon_start=1
/product="glycogen synthase kinase-3 alpha"
/protein_id="NP_063937.2"
/db_xref="GI:49574532"
/db_xref="CCDS:CCDS12599.1"
/db_xref="GeneID:2931"
/db_xref="HGNC:4616"
/db_xref="MIM:606784"
/translation="
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLPPLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLTNSS
"
misc_feature 123..125
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="N-acetylserine; propagated from
UniProtKB/Swiss-Prot (P49840.2); acetylation site"
misc_feature 123..125
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P49840.2); phosphorylation site"
misc_feature 180..182
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by PKB/AKT1; propagated from
UniProtKB/Swiss-Prot (P49840.2); phosphorylation site"
misc_feature 180..182
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01498"
misc_feature 180..182
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01499"
misc_feature 180..182
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01501"
misc_feature 180..182
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01502"
misc_feature 180..182
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03382"
misc_feature 180..182
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:06151"
misc_feature 180..182
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:06349"
misc_feature 180..182
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/citation=[8]
/db_xref="HPRD:01261"
misc_feature 180..182
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:04264"
misc_feature 333..335
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P49840.2); phosphorylation site"
misc_feature 348..350
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P49840.2); phosphorylation site"
misc_feature 408..410
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P49840.2); phosphorylation site"
misc_feature 474..1328
/gene="GSK3A"
/note="Protein Kinases, catalytic domain; Region:
PKc_like; cl09925"
/db_xref="CDD:213116"
misc_feature 474..1328
/gene="GSK3A"
/note="Protein kinase domain; Region: Pkinase; pfam00069"
/db_xref="CDD:200973"
misc_feature order(492..506,516..518,555..557,561..563,636..638,
702..713,729..731,735..737,849..851,855..857,861..866,
870..872,906..908,915..917,960..971)
/gene="GSK3A"
/note="active site"
/db_xref="CDD:173623"
misc_feature order(492..506,516..518,555..557,561..563,636..638,
702..713,729..731,849..851,855..857,861..866,870..872,
906..908)
/gene="GSK3A"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:173623"
misc_feature order(504..506,729..731,735..737,849..851,855..857,
861..863,915..917,960..971)
/gene="GSK3A"
/note="substrate binding site [chemical binding]; other
site"
/db_xref="CDD:173623"
misc_feature order(903..923,960..971)
/gene="GSK3A"
/note="activation loop (A-loop); other site"
/db_xref="CDD:173623"
misc_feature 951..953
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:06002"
misc_feature 954..956
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 954..956
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 954..956
/gene="GSK3A"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:06002"
exon 403..590
/gene="GSK3A"
/inference="alignment:Splign:1.39.8"
STS 414..564
/gene="GSK3A"
/standard_name="D19S688E"
/db_xref="UniSTS:150587"
exon 591..674
/gene="GSK3A"
/inference="alignment:Splign:1.39.8"
exon 675..785
/gene="GSK3A"
/inference="alignment:Splign:1.39.8"
STS 753..815
/gene="GSK3A"
/standard_name="MARC_17709-17710:1031755211:1"
/db_xref="UniSTS:268383"
exon 786..916
/gene="GSK3A"
/inference="alignment:Splign:1.39.8"
exon 917..1023
/gene="GSK3A"
/inference="alignment:Splign:1.39.8"
exon 1024..1121
/gene="GSK3A"
/inference="alignment:Splign:1.39.8"
STS 1122..1355
/gene="GSK3A"
/standard_name="RH11670"
/db_xref="UniSTS:39033"
exon 1122..1217
/gene="GSK3A"
/inference="alignment:Splign:1.39.8"
STS 1213..1355
/gene="GSK3A"
/standard_name="SHGC-32066"
/db_xref="UniSTS:39032"
exon 1218..1404
/gene="GSK3A"
/inference="alignment:Splign:1.39.8"
exon 1405..1497
/gene="GSK3A"
/inference="alignment:Splign:1.39.8"
exon 1498..2179
/gene="GSK3A"
/inference="alignment:Splign:1.39.8"
variation 1835
/gene="GSK3A"
/replace="c"
/replace="t"
/db_xref="dbSNP:1054311"
STS 1914..1999
/gene="GSK3A"
/standard_name="D19S656E"
/db_xref="UniSTS:150570"
variation 2041
/gene="GSK3A"
/replace="c"
/replace="t"
/db_xref="dbSNP:1054318"
variation 2097
/gene="GSK3A"
/replace="a"
/replace="g"
/db_xref="dbSNP:1802524"
variation 2111
/gene="GSK3A"
/replace="c"
/replace="t"
/db_xref="dbSNP:1054370"
variation 2121
/gene="GSK3A"
/replace="a"
/replace="c"
/db_xref="dbSNP:1054371"
ORIGIN
cccaagccagagcggcgcggcctggaagaggccagggcccgggggaggcggcggcagcggcggcggctggggcagcccgggcagcccgagccccgcagcctgggcctgtgctcggcgccatgagcggcggcgggccttcgggaggcggccctgggggctcgggcagggcgcggactagctcgttcgcggagcccggcggcggaggcggaggaggcggcggcggccccggaggctcggcctccggcccaggcggcaccggcggcggaaaggcatctgtcggggccatgggtgggggcgtcggggcctcgagctccgggggtggacccggcggcagcggcggaggaggcagcggaggccccggcgcaggcactagcttcccgccgcccggggtgaagctgggccgtgacagcgggaaggtgaccacagtcgtagccactctaggccaaggcccagagcgctcccaagaagtggcttacacggacatcaaagtgattggcaatggctcatttggggtcgtgtaccaggcacggctggcagagaccagggaactagtcgccatcaagaaggttctccaggacaagaggttcaagaaccgagagctgcagatcatgcgtaagctggaccactgcaatattgtgaggctgagatactttttctactccagtggcgagaagaaagacgagctttacctaaatctggtgctggaatatgtgcccgagacagtgtaccgggtggcccgccacttcaccaaggccaagttgaccatccctatcctctatgtcaaggtgtacatgtaccagctcttccgcagcttggcctacatccactcccagggcgtgtgtcaccgcgacatcaagccccagaacctgctggtggaccctgacactgctgtcctcaagctctgcgattttggcagtgcaaagcagttggtccgaggggagcccaatgtctcctacatctgttctcgctactaccgggccccagagctcatctttggagccactgattacacctcatccatcgatgtttggtcagctggctgtgtactggcagagctcctcttgggccagcccatcttccctggggacagtggggtggaccagctggtggagatcatcaaggtgctgggaacaccaacccgggaacaaatccgagagatgaaccccaactacacggagttcaagttccctcagattaaagctcacccctggacaaaggtgttcaaatctcgaacgccgccagaggccatcgcgctctgctctagcctgctggagtacaccccatcctcaaggctctccccactagaggcctgtgcgcacagcttctttgatgaactgcgatgtctgggaacccagctgcctaacaaccgcccacttccccctctcttcaacttcagtgctggtgaactctccatccaaccgtctctcaacgccattctcatccctcctcacttgaggtccccagcgggcactaccaccctcaccccgtcctcacaagctttaactgagactccgaccagctcagactggcagtcgaccgatgccacacctaccctcactaactcctcctgagggccccaccaagcacccttccacttccatctgggagccccaagaggggctgggaaggggggccatagcccatcaagctcctgccctggctgggcccctagactagagggcagaggtaaatgagtccctgtccccacctccagtccctccctcaccagcctcacccctgtggtgggctttttaagaggattttaactggttgtggggagggaagagaaggacagggtgttggggggatgaggacctcctacccccttggccccctcccctcccccagacctccacctcctccagaccccctcccctcctgtgtcccttgtaaatagaaccagcccagcccgtctcctcttcccttccctggcccccgggtgtaaatagattgttataatttttttcttaaagaaaacgtcgattcgcaccgtccaacctggccccgcccctcctacagctgtaactcccctcctgtcctctgcccccaaggtctactccctcctcaccccaccctggagggccaggggagtggagagagctcctgatgtcttagtttccacagtaaggtttgcctgtgtacagacctccgttcaataaattattggcatgaaaacctgaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:2931 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IDA
GeneID:2931 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:2931 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA
GeneID:2931 -> Molecular function: GO:0034236 [protein kinase A catalytic subunit binding] evidence: IPI
GeneID:2931 -> Molecular function: GO:0050321 [tau-protein kinase activity] evidence: TAS
GeneID:2931 -> Biological process: GO:0003073 [regulation of systemic arterial blood pressure] evidence: ISS
GeneID:2931 -> Biological process: GO:0003214 [cardiac left ventricle morphogenesis] evidence: ISS
GeneID:2931 -> Biological process: GO:0005977 [glycogen metabolic process] evidence: IEA
GeneID:2931 -> Biological process: GO:0006349 [regulation of gene expression by genetic imprinting] evidence: IEA
GeneID:2931 -> Biological process: GO:0006468 [protein phosphorylation] evidence: IDA
GeneID:2931 -> Biological process: GO:0006987 [activation of signaling protein activity involved in unfolded protein response] evidence: TAS
GeneID:2931 -> Biological process: GO:0007173 [epidermal growth factor receptor signaling pathway] evidence: TAS
GeneID:2931 -> Biological process: GO:0007399 [nervous system development] evidence: IEA
GeneID:2931 -> Biological process: GO:0008286 [insulin receptor signaling pathway] evidence: ISS
GeneID:2931 -> Biological process: GO:0008543 [fibroblast growth factor receptor signaling pathway] evidence: TAS
GeneID:2931 -> Biological process: GO:0010800 [positive regulation of peptidyl-threonine phosphorylation] evidence: IEA
GeneID:2931 -> Biological process: GO:0010905 [negative regulation of UDP-glucose catabolic process] evidence: IC
GeneID:2931 -> Biological process: GO:0016055 [Wnt receptor signaling pathway] evidence: IEA
GeneID:2931 -> Biological process: GO:0016477 [cell migration] evidence: IEA
GeneID:2931 -> Biological process: GO:0030819 [positive regulation of cAMP biosynthetic process] evidence: ISS
GeneID:2931 -> Biological process: GO:0030968 [endoplasmic reticulum unfolded protein response] evidence: TAS
GeneID:2931 -> Biological process: GO:0032007 [negative regulation of TOR signaling cascade] evidence: ISS
GeneID:2931 -> Biological process: GO:0032869 [cellular response to insulin stimulus] evidence: IMP
GeneID:2931 -> Biological process: GO:0033138 [positive regulation of peptidyl-serine phosphorylation] evidence: IEA
GeneID:2931 -> Biological process: GO:0038095 [Fc-epsilon receptor signaling pathway] evidence: TAS
GeneID:2931 -> Biological process: GO:0044027 [hypermethylation of CpG island] evidence: IEA
GeneID:2931 -> Biological process: GO:0044267 [cellular protein metabolic process] evidence: TAS
GeneID:2931 -> Biological process: GO:0045087 [innate immune response] evidence: TAS
GeneID:2931 -> Biological process: GO:0045719 [negative regulation of glycogen biosynthetic process] evidence: TAS
GeneID:2931 -> Biological process: GO:0045732 [positive regulation of protein catabolic process] evidence: NAS
GeneID:2931 -> Biological process: GO:0045823 [positive regulation of heart contraction] evidence: ISS
GeneID:2931 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IEA
GeneID:2931 -> Biological process: GO:0046325 [negative regulation of glucose import] evidence: IMP
GeneID:2931 -> Biological process: GO:0046627 [negative regulation of insulin receptor signaling pathway] evidence: IMP
GeneID:2931 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS
GeneID:2931 -> Biological process: GO:0048015 [phosphatidylinositol-mediated signaling] evidence: TAS
GeneID:2931 -> Biological process: GO:0051348 [negative regulation of transferase activity] evidence: IMP
GeneID:2931 -> Biological process: GO:0061052 [negative regulation of cell growth involved in cardiac muscle cell development] evidence: ISS
GeneID:2931 -> Biological process: GO:0071285 [cellular response to lithium ion] evidence: IEA
GeneID:2931 -> Biological process: GO:0071407 [cellular response to organic cyclic compound] evidence: IEA
GeneID:2931 -> Biological process: GO:0071879 [positive regulation of adrenergic receptor signaling pathway] evidence: ISS
GeneID:2931 -> Biological process: GO:0090090 [negative regulation of canonical Wnt receptor signaling pathway] evidence: TAS
GeneID:2931 -> Biological process: GO:2000077 [negative regulation of type B pancreatic cell development] evidence: TAS
GeneID:2931 -> Biological process: GO:2000466 [negative regulation of glycogen (starch) synthase activity] evidence: TAS
GeneID:2931 -> Biological process: GO:2000467 [positive regulation of glycogen (starch) synthase activity] evidence: ISS
GeneID:2931 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:2931 -> Cellular component: GO:0030877 [beta-catenin destruction complex] evidence: NAS
GeneID:2931 -> Cellular component: GO:0030877 [beta-catenin destruction complex] evidence: TAS
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_063937 -> EC 2.7.11.1
NP_063937 -> EC 2.7.11.26
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.