2024-04-24 16:37:33, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_015982 1606 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens Y box binding protein 2 (YBX2), mRNA. ACCESSION NM_015982 VERSION NM_015982.3 GI:156415989 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1606) AUTHORS Aston,K.I., Krausz,C., Laface,I., Ruiz-Castane,E. and Carrell,D.T. TITLE Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent JOURNAL Hum. Reprod. 25 (6), 1383-1397 (2010) PUBMED 20378615 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 2 (bases 1 to 1606) AUTHORS Hammoud,S., Emery,B.R., Dunn,D., Weiss,R.B. and Carrell,D.T. TITLE Sequence alterations in the YBX2 gene are associated with male factor infertility JOURNAL Fertil. Steril. 91 (4), 1090-1095 (2009) PUBMED 18339382 REMARK GeneRIF: A significant association between gene alterations in the YBX2 gene and abnormal spermatogenesis in humans, including a potential role in altering protamine expression, and implicate YBX2 gene alterations as a potential cause of male factor infertility. GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 3 (bases 1 to 1606) AUTHORS Deng,Y., Zhang,W., Su,D., Yang,Y., Ma,Y., Zhang,H. and Zhang,S. TITLE Some single nucleotide polymorphisms of MSY2 gene might contribute to susceptibility to spermatogenic impairment in idiopathic infertile men JOURNAL Urology 71 (5), 878-882 (2008) PUBMED 18372033 REMARK GeneRIF: some polymorphisms of the MSY2 gene might be associated with impaired spermatogenesis and that the gene could also be involved in modifying the susceptibility to idiopathic spermatogenic impairment in humans GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 4 (bases 1 to 1606) AUTHORS Girard,A., Sachidanandam,R., Hannon,G.J. and Carmell,M.A. TITLE A germline-specific class of small RNAs binds mammalian Piwi proteins JOURNAL Nature 442 (7099), 199-202 (2006) PUBMED 16751776 REFERENCE 5 (bases 1 to 1606) AUTHORS Kohno,Y., Matsuki,Y., Tanimoto,A., Izumi,H., Uchiumi,T., Kohno,K., Shimajiri,S. and Sasaguri,Y. TITLE Expression of Y-box-binding protein dbpC/contrin, a potentially new cancer/testis antigen JOURNAL Br. J. Cancer 94 (5), 710-716 (2006) PUBMED 16479255 REMARK GeneRIF: provides first evidence showing dbpC highly expressed in human testicular seminoma and ovarian dysgerminomas, and in carcinomas in other tissues and that its expression in normal tissues is nearly restricted to germ cells and placental trophoblasts REFERENCE 6 (bases 1 to 1606) AUTHORS Yoshida,T., Izumi,H., Uchiumi,T., Sasaguri,Y., Tanimoto,A., Matsumoto,T., Naito,S. and Kohno,K. TITLE Expression and cellular localization of dbpC/Contrin in germ cell tumor cell lines JOURNAL Biochim. Biophys. Acta 1759 (1-2), 80-88 (2006) PUBMED 16624424 REMARK GeneRIF: transcriptional regulation of Contrin was investigated, and the promoter region between -272 and -253 relative to the transcription start site was shown to be critical for the manifestation of cell-type specific transcription REFERENCE 7 (bases 1 to 1606) AUTHORS Tekur,S., Pawlak,A., Guellaen,G. and Hecht,N.B. TITLE Contrin, the human homologue of a germ-cell Y-box-binding protein: cloning, expression, and chromosomal localization JOURNAL J. Androl. 20 (1), 135-144 (1999) PUBMED 10100484 REFERENCE 8 (bases 1 to 1606) AUTHORS Gu,W., Tekur,S., Reinbold,R., Eppig,J.J., Choi,Y.C., Zheng,J.Z., Murray,M.T. and Hecht,N.B. TITLE Mammalian male and female germ cells express a germ cell-specific Y-Box protein, MSY2 JOURNAL Biol. Reprod. 59 (5), 1266-1274 (1998) PUBMED 9780336 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DB065912.1, BC033800.1 and AI805280.1. On Aug 24, 2007 this sequence version replaced gi:142361318. Summary: This gene encodes a nucleic acid binding protein which is highly expressed in germ cells. The encoded protein binds to a Y-box element in the promoters of certain genes but also binds to mRNA transcribed from these genes. Pseudogenes for this gene are located on chromosome 10 and 15. [provided by RefSeq, Feb 2012]. ##Evidence-Data-START## Transcript exon combination :: BC047760.1, AF096834.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025088 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-37 DB065912.1 1-37 38-1571 BC033800.1 1-1534 1572-1606 AI805280.1 1-35 c FEATURES Location/Qualifiers source 1..1606 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="17" /map="17p13.1" gene 1..1606 /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" /note="Y box binding protein 2" /db_xref="GeneID:51087" /db_xref="HGNC:17948" /db_xref="MIM:611447" exon 1..328 /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" /inference="alignment:Splign:1.39.8" CDS 58..1152 /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" /note="germ cell specific Y-box binding protein; MSY2 homolog; DNA-binding protein C; germ cell-specific Y-box-binding protein" /codon_start=1 /product="Y-box-binding protein 2" /protein_id="NP_057066.2" /db_xref="GI:156415990" /db_xref="CCDS:CCDS11098.1" /db_xref="GeneID:51087" /db_xref="HGNC:17948" /db_xref="MIM:611447" /translation="
MSEVEAAAGATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRRKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPPFFYRRRFVRGPRPPNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPRYRRPFRPRPRQQPTTEGGDGETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETSAPVNSGDPTTTILE
" misc_feature 316..564 /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9Y2T7.2); Region: Required for cytoplasmic retention (By similarity)" misc_feature 343..543 /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" /note="Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea. CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box protein; Region: CSP_CDS; cd04458" /db_xref="CDD:88424" misc_feature order(355..357,382..384,415..417,514..516) /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" /note="DNA-binding site [nucleotide binding]; DNA binding site" /db_xref="CDD:88424" misc_feature order(373..393,412..423) /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" /note="RNA-binding motif; other site" /db_xref="CDD:88424" misc_feature 706..1149 /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9Y2T7.2); Region: Required for mRNA-binding" variation 83..84 /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" /replace="g" /replace="t" /db_xref="dbSNP:11547795" exon 329..392 /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" /inference="alignment:Splign:1.39.8" exon 393..426 /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" /inference="alignment:Splign:1.39.8" exon 427..516 /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" /inference="alignment:Splign:1.39.8" exon 517..801 /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" /inference="alignment:Splign:1.39.8" exon 802..905 /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" /inference="alignment:Splign:1.39.8" exon 906..1101 /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" /inference="alignment:Splign:1.39.8" exon 1102..1191 /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" /inference="alignment:Splign:1.39.8" exon 1192..1583 /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" /inference="alignment:Splign:1.39.8" polyA_site 1572 /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" polyA_site 1583 /gene="YBX2" /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2" ORIGIN
gagccggggggaggggccggggcggtggcggctgtggccggtactggacccggcgggatgagcgaggtggaggcggcagcgggggctacagcggtccccgcggcgacggtgcccgcgacggcggcaggggtggtagcggtggtggtaccggtgcccgcaggggagccgcagaaaggcggcggggcgggcggcgggggcggagccgcctcgggccccgctgctgggaccccctcggcgccgggctcccgcacccctggcaatccggcgacggcggtctcgggaacccccgcccccccggcccggagtcaggcggacaagccggtgctggcaatccaagtcctgggcactgtcaaatggttcaacgtccggaatggttacggattcatcaacaggaatgacaccaaggaagatgtctttgttcaccagacagctattaaaagaaacaaccccaggaagtttctgcgcagcgttggagatggggagactgtggaatttgatgtcgtggaaggagagaagggcgcagaagccactaatgtaactgggcctgggggagtacccgtgaagggcagccgttatgcccccaaccgacgtaagtcccgccgattcatcccccggcctccctcagttgccccaccacccatggtggcagagatcccctcggcggggacaggacctggcagtaaaggggagcgggctgaagactctgggcaacggccccgacgatggtgccccccacccttcttctaccgacggcggtttgtgcgaggcccccggcctcccaaccagcagcagcctatagagggcactgacagggtagaacccaaagagacagccccattggaggggcaccaacagcagggagatgagcgagtccccccgcccagattccggcccaggtaccgaaggcctttccgccccaggccacgccagcagcctaccacagaaggtggggatggtgagaccaagcccagccaaggtcccgctgatggttcccggcctgagccccagcgcccacgaaaccgcccctacttccagcggagacggcagcaggcccctggcccccagcaggcccctggcccccggcagcccgcagcccctgagacctcagcccctgtcaacagtggggaccccaccaccaccatcctggagtgattccaactcaactcagaggacacccagagctgccatctggtatctgccagtttttccaaatgacctgtaccctacccagtaccctgctccccctttcccataattcatgacatcaaaacaccagcttttcaccttttccttgagactcaggaggaccaaagcagcagccttttgctttttcttttttcttccctccccttatcaagggttgaaggaagggagccatccttactgttcagagacagcaactccctcccgtaactcaggctgagaaggaaccagccagctcttacctcctcctggttgcttttcttgcccccaccccaagtttatttttgttttcccccggccccctacctctgaagccattttatgatctgtcatgtgccacctgagcctccagtaaaaacaaaaacaggctttcctgtggtaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:51087 -> Molecular function: GO:0003677 [DNA binding] evidence: IEA GeneID:51087 -> Molecular function: GO:0003682 [chromatin binding] evidence: IEA GeneID:51087 -> Molecular function: GO:0003730 [mRNA 3'-UTR binding] evidence: IEA GeneID:51087 -> Molecular function: GO:0008289 [lipid binding] evidence: IEA GeneID:51087 -> Molecular function: GO:0043021 [ribonucleoprotein complex binding] evidence: IEA GeneID:51087 -> Molecular function: GO:0045182 [translation regulator activity] evidence: IEA GeneID:51087 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: IEA GeneID:51087 -> Biological process: GO:0006366 [transcription from RNA polymerase II promoter] evidence: TAS GeneID:51087 -> Biological process: GO:0007283 [spermatogenesis] evidence: TAS GeneID:51087 -> Biological process: GO:0007286 [spermatid development] evidence: IEA GeneID:51087 -> Biological process: GO:0009386 [translational attenuation] evidence: TAS GeneID:51087 -> Biological process: GO:0017148 [negative regulation of translation] evidence: IEA GeneID:51087 -> Biological process: GO:0048255 [mRNA stabilization] evidence: IEA GeneID:51087 -> Biological process: GO:0048599 [oocyte development] evidence: IEA GeneID:51087 -> Biological process: GO:0051100 [negative regulation of binding] evidence: IEA GeneID:51087 -> Cellular component: GO:0005634 [nucleus] evidence: IEA GeneID:51087 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA GeneID:51087 -> Cellular component: GO:0005844 [polysome] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.