Home |
Help |
Advanced search
2024-04-24 16:37:33, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_015982 1606 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens Y box binding protein 2 (YBX2), mRNA.
ACCESSION NM_015982
VERSION NM_015982.3 GI:156415989
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1606)
AUTHORS Aston,K.I., Krausz,C., Laface,I., Ruiz-Castane,E. and Carrell,D.T.
TITLE Evaluation of 172 candidate polymorphisms for association with
oligozoospermia or azoospermia in a large cohort of men of European
descent
JOURNAL Hum. Reprod. 25 (6), 1383-1397 (2010)
PUBMED 20378615
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 2 (bases 1 to 1606)
AUTHORS Hammoud,S., Emery,B.R., Dunn,D., Weiss,R.B. and Carrell,D.T.
TITLE Sequence alterations in the YBX2 gene are associated with male
factor infertility
JOURNAL Fertil. Steril. 91 (4), 1090-1095 (2009)
PUBMED 18339382
REMARK GeneRIF: A significant association between gene alterations in the
YBX2 gene and abnormal spermatogenesis in humans, including a
potential role in altering protamine expression, and implicate YBX2
gene alterations as a potential cause of male factor infertility.
GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 3 (bases 1 to 1606)
AUTHORS Deng,Y., Zhang,W., Su,D., Yang,Y., Ma,Y., Zhang,H. and Zhang,S.
TITLE Some single nucleotide polymorphisms of MSY2 gene might contribute
to susceptibility to spermatogenic impairment in idiopathic
infertile men
JOURNAL Urology 71 (5), 878-882 (2008)
PUBMED 18372033
REMARK GeneRIF: some polymorphisms of the MSY2 gene might be associated
with impaired spermatogenesis and that the gene could also be
involved in modifying the susceptibility to idiopathic
spermatogenic impairment in humans
GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 4 (bases 1 to 1606)
AUTHORS Girard,A., Sachidanandam,R., Hannon,G.J. and Carmell,M.A.
TITLE A germline-specific class of small RNAs binds mammalian Piwi
proteins
JOURNAL Nature 442 (7099), 199-202 (2006)
PUBMED 16751776
REFERENCE 5 (bases 1 to 1606)
AUTHORS Kohno,Y., Matsuki,Y., Tanimoto,A., Izumi,H., Uchiumi,T., Kohno,K.,
Shimajiri,S. and Sasaguri,Y.
TITLE Expression of Y-box-binding protein dbpC/contrin, a potentially new
cancer/testis antigen
JOURNAL Br. J. Cancer 94 (5), 710-716 (2006)
PUBMED 16479255
REMARK GeneRIF: provides first evidence showing dbpC highly expressed in
human testicular seminoma and ovarian dysgerminomas, and in
carcinomas in other tissues and that its expression in normal
tissues is nearly restricted to germ cells and placental
trophoblasts
REFERENCE 6 (bases 1 to 1606)
AUTHORS Yoshida,T., Izumi,H., Uchiumi,T., Sasaguri,Y., Tanimoto,A.,
Matsumoto,T., Naito,S. and Kohno,K.
TITLE Expression and cellular localization of dbpC/Contrin in germ cell
tumor cell lines
JOURNAL Biochim. Biophys. Acta 1759 (1-2), 80-88 (2006)
PUBMED 16624424
REMARK GeneRIF: transcriptional regulation of Contrin was investigated,
and the promoter region between -272 and -253 relative to the
transcription start site was shown to be critical for the
manifestation of cell-type specific transcription
REFERENCE 7 (bases 1 to 1606)
AUTHORS Tekur,S., Pawlak,A., Guellaen,G. and Hecht,N.B.
TITLE Contrin, the human homologue of a germ-cell Y-box-binding protein:
cloning, expression, and chromosomal localization
JOURNAL J. Androl. 20 (1), 135-144 (1999)
PUBMED 10100484
REFERENCE 8 (bases 1 to 1606)
AUTHORS Gu,W., Tekur,S., Reinbold,R., Eppig,J.J., Choi,Y.C., Zheng,J.Z.,
Murray,M.T. and Hecht,N.B.
TITLE Mammalian male and female germ cells express a germ cell-specific
Y-Box protein, MSY2
JOURNAL Biol. Reprod. 59 (5), 1266-1274 (1998)
PUBMED 9780336
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
DB065912.1, BC033800.1 and AI805280.1.
On Aug 24, 2007 this sequence version replaced gi:142361318.
Summary: This gene encodes a nucleic acid binding protein which is
highly expressed in germ cells. The encoded protein binds to a
Y-box element in the promoters of certain genes but also binds to
mRNA transcribed from these genes. Pseudogenes for this gene are
located on chromosome 10 and 15. [provided by RefSeq, Feb 2012].
##Evidence-Data-START##
Transcript exon combination :: BC047760.1, AF096834.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025088 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-37 DB065912.1 1-37
38-1571 BC033800.1 1-1534
1572-1606 AI805280.1 1-35 c
FEATURES Location/Qualifiers
source 1..1606
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="17"
/map="17p13.1"
gene 1..1606
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
/note="Y box binding protein 2"
/db_xref="GeneID:51087"
/db_xref="HGNC:17948"
/db_xref="MIM:611447"
exon 1..328
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
/inference="alignment:Splign:1.39.8"
CDS 58..1152
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
/note="germ cell specific Y-box binding protein; MSY2
homolog; DNA-binding protein C; germ cell-specific
Y-box-binding protein"
/codon_start=1
/product="Y-box-binding protein 2"
/protein_id="NP_057066.2"
/db_xref="GI:156415990"
/db_xref="CCDS:CCDS11098.1"
/db_xref="GeneID:51087"
/db_xref="HGNC:17948"
/db_xref="MIM:611447"
/translation="
MSEVEAAAGATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRRKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPPFFYRRRFVRGPRPPNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPRYRRPFRPRPRQQPTTEGGDGETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETSAPVNSGDPTTTILE
"
misc_feature 316..564
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9Y2T7.2);
Region: Required for cytoplasmic retention (By
similarity)"
misc_feature 343..543
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
/note="Cold-Shock Protein (CSP) contains an S1-like
cold-shock domain (CSD) that is found in eukaryotes,
prokaryotes, and archaea. CSP's include the major
cold-shock proteins CspA and CspB in bacteria and the
eukaryotic gene regulatory factor Y-box protein; Region:
CSP_CDS; cd04458"
/db_xref="CDD:88424"
misc_feature order(355..357,382..384,415..417,514..516)
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
/note="DNA-binding site [nucleotide binding]; DNA binding
site"
/db_xref="CDD:88424"
misc_feature order(373..393,412..423)
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
/note="RNA-binding motif; other site"
/db_xref="CDD:88424"
misc_feature 706..1149
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9Y2T7.2);
Region: Required for mRNA-binding"
variation 83..84
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
/replace="g"
/replace="t"
/db_xref="dbSNP:11547795"
exon 329..392
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
/inference="alignment:Splign:1.39.8"
exon 393..426
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
/inference="alignment:Splign:1.39.8"
exon 427..516
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
/inference="alignment:Splign:1.39.8"
exon 517..801
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
/inference="alignment:Splign:1.39.8"
exon 802..905
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
/inference="alignment:Splign:1.39.8"
exon 906..1101
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
/inference="alignment:Splign:1.39.8"
exon 1102..1191
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
/inference="alignment:Splign:1.39.8"
exon 1192..1583
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
/inference="alignment:Splign:1.39.8"
polyA_site 1572
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
polyA_site 1583
/gene="YBX2"
/gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
ORIGIN
gagccggggggaggggccggggcggtggcggctgtggccggtactggacccggcgggatgagcgaggtggaggcggcagcgggggctacagcggtccccgcggcgacggtgcccgcgacggcggcaggggtggtagcggtggtggtaccggtgcccgcaggggagccgcagaaaggcggcggggcgggcggcgggggcggagccgcctcgggccccgctgctgggaccccctcggcgccgggctcccgcacccctggcaatccggcgacggcggtctcgggaacccccgcccccccggcccggagtcaggcggacaagccggtgctggcaatccaagtcctgggcactgtcaaatggttcaacgtccggaatggttacggattcatcaacaggaatgacaccaaggaagatgtctttgttcaccagacagctattaaaagaaacaaccccaggaagtttctgcgcagcgttggagatggggagactgtggaatttgatgtcgtggaaggagagaagggcgcagaagccactaatgtaactgggcctgggggagtacccgtgaagggcagccgttatgcccccaaccgacgtaagtcccgccgattcatcccccggcctccctcagttgccccaccacccatggtggcagagatcccctcggcggggacaggacctggcagtaaaggggagcgggctgaagactctgggcaacggccccgacgatggtgccccccacccttcttctaccgacggcggtttgtgcgaggcccccggcctcccaaccagcagcagcctatagagggcactgacagggtagaacccaaagagacagccccattggaggggcaccaacagcagggagatgagcgagtccccccgcccagattccggcccaggtaccgaaggcctttccgccccaggccacgccagcagcctaccacagaaggtggggatggtgagaccaagcccagccaaggtcccgctgatggttcccggcctgagccccagcgcccacgaaaccgcccctacttccagcggagacggcagcaggcccctggcccccagcaggcccctggcccccggcagcccgcagcccctgagacctcagcccctgtcaacagtggggaccccaccaccaccatcctggagtgattccaactcaactcagaggacacccagagctgccatctggtatctgccagtttttccaaatgacctgtaccctacccagtaccctgctccccctttcccataattcatgacatcaaaacaccagcttttcaccttttccttgagactcaggaggaccaaagcagcagccttttgctttttcttttttcttccctccccttatcaagggttgaaggaagggagccatccttactgttcagagacagcaactccctcccgtaactcaggctgagaaggaaccagccagctcttacctcctcctggttgcttttcttgcccccaccccaagtttatttttgttttcccccggccccctacctctgaagccattttatgatctgtcatgtgccacctgagcctccagtaaaaacaaaaacaggctttcctgtggtaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:51087 -> Molecular function: GO:0003677 [DNA binding] evidence: IEA
GeneID:51087 -> Molecular function: GO:0003682 [chromatin binding] evidence: IEA
GeneID:51087 -> Molecular function: GO:0003730 [mRNA 3'-UTR binding] evidence: IEA
GeneID:51087 -> Molecular function: GO:0008289 [lipid binding] evidence: IEA
GeneID:51087 -> Molecular function: GO:0043021 [ribonucleoprotein complex binding] evidence: IEA
GeneID:51087 -> Molecular function: GO:0045182 [translation regulator activity] evidence: IEA
GeneID:51087 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: IEA
GeneID:51087 -> Biological process: GO:0006366 [transcription from RNA polymerase II promoter] evidence: TAS
GeneID:51087 -> Biological process: GO:0007283 [spermatogenesis] evidence: TAS
GeneID:51087 -> Biological process: GO:0007286 [spermatid development] evidence: IEA
GeneID:51087 -> Biological process: GO:0009386 [translational attenuation] evidence: TAS
GeneID:51087 -> Biological process: GO:0017148 [negative regulation of translation] evidence: IEA
GeneID:51087 -> Biological process: GO:0048255 [mRNA stabilization] evidence: IEA
GeneID:51087 -> Biological process: GO:0048599 [oocyte development] evidence: IEA
GeneID:51087 -> Biological process: GO:0051100 [negative regulation of binding] evidence: IEA
GeneID:51087 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
GeneID:51087 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
GeneID:51087 -> Cellular component: GO:0005844 [polysome] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.