GGRNA Home | Help | Advanced search

2024-03-29 16:58:23, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_014588               2216 bp    mRNA    linear   PRI 01-JUL-2013
DEFINITION  Homo sapiens visual system homeobox 1 (VSX1), transcript variant 1,
            mRNA.
ACCESSION   NM_014588
VERSION     NM_014588.5  GI:372282476
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2216)
  AUTHORS   Verma,A., Das,M., Srinivasan,M., Prajna,N.V. and Sundaresan,P.
  TITLE     Investigation of VSX1 sequence variants in South Indian patients
            with sporadic cases of keratoconus
  JOURNAL   BMC Res Notes 6, 103 (2013)
   PUBMED   23506487
  REMARK    GeneRIF: lack of VSX1 pathogenic variations in a large number of
            unrelated sporadic keratoconus patients tend to omit its role, and
            corroborate the involvement of other genetic, environmental or
            behavioural factors in the development of this complex disorder
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2216)
  AUTHORS   Jeoung,J.W., Kim,M.K., Park,S.S., Kim,S.Y., Ko,H.S., Wee,W.R. and
            Lee,J.H.
  TITLE     VSX1 gene and keratoconus: genetic analysis in Korean patients
  JOURNAL   Cornea 31 (7), 746-750 (2012)
   PUBMED   22531431
  REMARK    GeneRIF: Our results suggest that the VSX1 gene and its mutations
            with amino acid changes do not play a major role in the
            pathogenesis of keratoconus.
REFERENCE   3  (bases 1 to 2216)
  AUTHORS   Saee-Rad,S., Hashemi,H., Miraftab,M., Noori-Daloii,M.R.,
            Chaleshtori,M.H., Raoofian,R., Jafari,F., Greene,W., Fakhraie,G.,
            Rezvan,F. and Heidari,M.
  TITLE     Mutation analysis of VSX1 and SOD1 in Iranian patients with
            keratoconus
  JOURNAL   Mol. Vis. 17, 3128-3136 (2011)
   PUBMED   22171159
  REMARK    GeneRIF: A significant association between keratoconus patients and
            VSX1 genetic alterations, is reported.
REFERENCE   4  (bases 1 to 2216)
  AUTHORS   De Bonis,P., Laborante,A., Pizzicoli,C., Stallone,R., Barbano,R.,
            Longo,C., Mazzilli,E., Zelante,L. and Bisceglia,L.
  TITLE     Mutational screening of VSX1, SPARC, SOD1, LOX, and TIMP3 in
            keratoconus
  JOURNAL   Mol. Vis. 17, 2482-2494 (2011)
   PUBMED   21976959
  REMARK    GeneRIF: A novel mutation p.G239R and previously reported mutations
            were found in VSX1 in Italian patients with keratoconus.
REFERENCE   5  (bases 1 to 2216)
  AUTHORS   Dorval,K.M., Bobechko,B.P., Ahmad,K.F. and Bremner,R.
  TITLE     Transcriptional activity of the paired-like homeodomain proteins
            CHX10 and VSX1
  JOURNAL   J. Biol. Chem. 280 (11), 10100-10108 (2005)
   PUBMED   15647262
  REMARK    GeneRIF: CHX10 and VSX1 may control retinal bipolar cell
            specification or differentiation by repressing genes required for
            the development of other cell types
REFERENCE   6  (bases 1 to 2216)
  AUTHORS   Bisceglia,L., Ciaschetti,M., De Bonis,P., Campo,P.A., Pizzicoli,C.,
            Scala,C., Grifa,M., Ciavarella,P., Delle Noci,N., Vaira,F.,
            Macaluso,C. and Zelante,L.
  TITLE     VSX1 mutational analysis in a series of Italian patients affected
            by keratoconus: detection of a novel mutation
  JOURNAL   Invest. Ophthalmol. Vis. Sci. 46 (1), 39-45 (2005)
   PUBMED   15623752
  REMARK    GeneRIF: Mutational analysis of the VSX1 gene in a series of
            Italian patients revealed one novel mutation and confirmed an
            important role played by this gene in a significant proportion of
            patients affected by keratoconus
            GeneRIF: Observational study of genotype prevalence. (HuGE
            Navigator)
REFERENCE   7  (bases 1 to 2216)
  AUTHORS   Mintz-Hittner,H.A., Semina,E.V., Frishman,L.J., Prager,T.C. and
            Murray,J.C.
  TITLE     VSX1 (RINX) mutation with craniofacial anomalies, empty sella,
            corneal endothelial changes, and abnormal retinal and auditory
            bipolar cells
  JOURNAL   Ophthalmology 111 (4), 828-836 (2004)
   PUBMED   15051220
  REMARK    GeneRIF: The new mutation in the VSX1 (RINX) gene described in this
            report results in abnormal craniofacial features, absence of the
            roof of the sella turcica, and anomalous development of the corneal
            endothelium.
REFERENCE   8  (bases 1 to 2216)
  AUTHORS   Heon,E., Greenberg,A., Kopp,K.K., Rootman,D., Vincent,A.L.,
            Billingsley,G., Priston,M., Dorval,K.M., Chow,R.L., McInnes,R.R.,
            Heathcote,G., Westall,C., Sutphin,J.E., Semina,E., Bremner,R. and
            Stone,E.M.
  TITLE     VSX1: a gene for posterior polymorphous dystrophy and keratoconus
  JOURNAL   Hum. Mol. Genet. 11 (9), 1029-1036 (2002)
   PUBMED   11978762
  REMARK    GeneRIF: Mutations in VSX1 homeobox gene results in impaired DNA
            binding and is associated with posterior polymorphous dystrophy and
            keratoconus
REFERENCE   9  (bases 1 to 2216)
  AUTHORS   Hayashi,T., Huang,J. and Deeb,S.S.
  TITLE     RINX(VSX1), a novel homeobox gene expressed in the inner nuclear
            layer of the adult retina
  JOURNAL   Genomics 67 (2), 128-139 (2000)
   PUBMED   10903837
REFERENCE   10 (bases 1 to 2216)
  AUTHORS   Semina,E.V., Mintz-Hittner,H.A. and Murray,J.C.
  TITLE     Isolation and characterization of a novel human paired-like
            homeodomain-containing transcription factor gene, VSX1, expressed
            in ocular tissues
  JOURNAL   Genomics 63 (2), 289-293 (2000)
   PUBMED   10673340
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL080312.14, AF176797.2 and
            DQ854807.1.
            This sequence is a reference standard in the RefSeqGene project.
            On Jan 15, 2012 this sequence version replaced gi:40806214.
            
            Summary: The protein encoded by this gene contains a paired-like
            homeodomain and binds to the core of the locus control region of
            the red/green visual pigment gene cluster. The encoded protein may
            regulate expression of the cone opsin genes early in development.
            Mutations in this gene can cause posterior polymorphous corneal
            dystrophy and keratoconus. Alternatively spliced transcript
            variants encoding different isoforms have been described. [provided
            by RefSeq, Jul 2008].
            
            Transcript Variant: This variant (1) encodes the longest isoform
            (a).
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DQ854807.1, AF251033.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025090 [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-32                AL080312.14        54677-54708         c
            33-248              AF176797.2         23-238
            249-2216            DQ854807.1         1-1968
FEATURES             Location/Qualifiers
     source          1..2216
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="20"
                     /map="20p11.21"
     gene            1..2216
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /note="visual system homeobox 1"
                     /db_xref="GeneID:30813"
                     /db_xref="HGNC:12723"
                     /db_xref="HPRD:09232"
                     /db_xref="MIM:605020"
     exon            1..707
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(10)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace=""
                     /replace="ggggtggggt"
                     /db_xref="dbSNP:55829223"
     variation       complement(19..28)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace=""
                     /replace="tgggg"
                     /replace="tggggtgggg"
                     /db_xref="dbSNP:10598910"
     variation       complement(19..23)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace=""
                     /replace="tgggg"
                     /db_xref="dbSNP:36209816"
     variation       complement(20..29)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace=""
                     /replace="ggggtggggt"
                     /db_xref="dbSNP:72106541"
     variation       complement(23..32)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace=""
                     /replace="gtggggtggg"
                     /db_xref="dbSNP:144366921"
     variation       complement(25..29)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace=""
                     /replace="ggggt"
                     /db_xref="dbSNP:376260893"
     variation       complement(87)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116022495"
     variation       complement(216)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374061441"
     STS             249..1431
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /db_xref="UniSTS:480772"
     STS             259..1406
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /db_xref="UniSTS:482128"
     STS             259..1402
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /db_xref="UniSTS:495222"
     misc_feature    275..277
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /note="upstream in-frame stop codon"
     CDS             284..1381
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /note="isoform a is encoded by transcript variant 1;
                     transcription factor VSX1; retinal inner nuclear layer
                     homeobox protein; homeodomain protein RINX"
                     /codon_start=1
                     /product="visual system homeobox 1 isoform a"
                     /protein_id="NP_055403.2"
                     /db_xref="GI:11056038"
                     /db_xref="CCDS:CCDS13168.1"
                     /db_xref="GeneID:30813"
                     /db_xref="HGNC:12723"
                     /db_xref="HPRD:09232"
                     /db_xref="MIM:605020"
                     /translation="
MTGRDSLSDGRTSSRALVPGGSPRGSRPRGFAITDLLGLEAELPAPAGPGQGSGCEGPAVAPCPGPGLDGSSLARGALPLGLGLLCGFGTQPPAAARAPCLLLADVPFLPPRGPEPAAPLAPSRPPPALGRQKRSDSVSTSDEDSQSEDRNDLKASPTLGKRKKRRHRTVFTAHQLEELEKAFSEAHYPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRKREKRWGGSSVMAEYGLYGAMVRHCIPLPDSVLNSAEGGLLGSCAPWLLGMHKKSMGMIRKPGSEDKLAGLWGSDHFKEGSSQSESGSQRGSDKVSPENGLEDVAIDLSSSARQETKKVHPGAGAQGGSNSTALEGPQPGKVGAT
"
     misc_feature    374..397
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9NZR4.2);
                     Region: Octapeptide motif"
     misc_feature    764..781
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9NZR4.2);
                     Region: Nuclear localization signal (Potential)"
     misc_feature    776..925
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(776..790,794..796,845..847,863..865,902..904,
                     908..913,920..925)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(782..784,791..793,911..913,920..925)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     variation       complement(285)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:192303122"
     variation       complement(301)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:8123716"
     variation       complement(314)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200446899"
     variation       333
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74315436"
     variation       complement(366)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370818926"
     variation       complement(456)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369865672"
     variation       complement(457)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:141241716"
     variation       complement(481)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112108176"
     variation       complement(598)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:6115023"
     variation       complement(622)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6037016"
     variation       complement(672)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:112232028"
     variation       complement(674)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:6050307"
     variation       675
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:267597889"
     variation       complement(677..678)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace=""
                     /replace="gcgggccc"
                     /db_xref="dbSNP:377273155"
     variation       complement(695)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:111722263"
     exon            708..786
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(715)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:140122268"
     variation       complement(718)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147161253"
     variation       complement(723)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200852410"
     variation       complement(735)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201716527"
     variation       complement(757)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199995626"
     variation       758
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:74315434"
     variation       762
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:74315433"
     variation       complement(768)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371672721"
     variation       779
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74315432"
     variation       complement(780)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150297220"
     exon            787..910
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(811)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143099682"
     variation       complement(829)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12480307"
     variation       complement(835)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200103903"
     variation       complement(839)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:138766673"
     variation       complement(863)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144917154"
     variation       complement(878)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201313323"
     variation       complement(879)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:75365206"
     variation       complement(895)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200369946"
     exon            911..1091
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(957)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140984142"
     variation       complement(973)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:146499972"
     variation       complement(993)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143704357"
     variation       complement(997)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375947949"
     variation       complement(1000)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141410824"
     variation       complement(1014)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148957473"
     variation       1049
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:74315435"
     variation       complement(1058)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368460658"
     exon            1092..2206
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1165)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145680548"
     variation       complement(1216)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:55877861"
     variation       complement(1256)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140989117"
     variation       complement(1277)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371077856"
     variation       complement(1286)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147741688"
     variation       complement(1338)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200952122"
     variation       complement(1350)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113233697"
     variation       complement(1384)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201807082"
     variation       complement(1391)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370506178"
     variation       complement(1485)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148709299"
     variation       complement(1580)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145201675"
     variation       complement(1581)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:75590263"
     variation       complement(1834)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:11478193"
     variation       complement(1877)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76499395"
     variation       complement(2004)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368909034"
     variation       complement(2122)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145378054"
     variation       complement(2125)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139744143"
     variation       complement(2126)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6050301"
     variation       complement(2130)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191546716"
     polyA_signal    2156..2161
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
     polyA_site      2179
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
     variation       complement(2201)
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186958062"
     polyA_site      2206
                     /gene="VSX1"
                     /gene_synonym="CAASDS; KTCN; KTCN1; PPCD; PPD; RINX"
ORIGIN      
cctagaatgggggtggggtggggtggggtgggctggacagaagagaggaggagaaggaggtgactgaggggactgcagctgggtgggcggtaaccgaggggaggggaactggtggcgtccccatctcgcggggtccggaacggcgacgcgcccgcgcccagctgattggagcccttcaggcctcccgcgcccgaccggcagcccaatcctataaagcttcctctaagctgggccctccgcaaacgggatccagagaggctcgcgccttgcttgctaaggaaccatgaccggccgggactcgctttccgacgggcgcactagcagcagggcgctggtgcctggcggttcccctaggggctcgcgcccccggggcttcgccatcacggacctgctgggcttggaggccgagctgccggcgcccgctggcccaggacagggatctggctgcgagggtccggcagtcgcgccgtgcccgggcccggggcttgacggctccagcctggcgcgtggggccctaccgctgggactcggcctcctctgtggcttcggcacgcagccgccggcggccgctcgagcaccctgcctgctcctagcggacgtgccgttcctgccgcccaggggccccgagcccgctgccccgctggctcccagccgtccgccgcctgcgctcggccgccagaagcgcagcgacagcgtctccacgtccgatgaggacagccagtctgaagacaggaatgacctaaaggcatcccccaccttgggcaagaggaagaagcggcggcacaggacagttttcactgctcaccagctggaagagttggagaaggcattcagcgaggcccactaccctgatgtgtatgcccgagaaatgctggctgtgaaaactgagctccccgaagaccggatacaggtctggtttcaaaaccgcagggccaaatggcgcaagcgggagaagcgctggggcggcagcagcgtgatggccgagtacgggctgtacggggccatggtgcgccactgcatcccgctgccagactccgtgctcaactccgccgagggcggcctgctgggctcctgcgcgccctggctcctggggatgcataaaaaatccatggggatgataaggaagccaggaagtgaagataagttggcaggactctggggctctgaccacttcaaagaaggttctagccagagtgagtcaggatcacagagaggctcagataaagtgagccctgagaatggcttggaagatgtggctattgacctctccagctctgcccggcaggagaccaagaaagtgcaccctggggctggtgctcaaggaggctccaactccacggcactggaggggccccagccagggaaggtgggagccacatgagacccacaggtcccactgtcaaaggctgaaaatgtgcatattcctcactggcattttccaaaagacaaaaattgtccaagacatatactctcagtttgattttcttctgacaatgtcaagataaaatgcaatgccacttgctttaagaggacagatgagtgacctagggaaaattctatttcattctagaatggaaacggttccttaatggcactttaaccagttaacttggtgcaaaacttttgattctcttttgtagcttgagcagggaggatccgaagttcaaaaatgatttcactgctgggcatcatttgagatgtgtggttcaatgtactgtatagatgaataggttaggtctgatgtcctcattctcaattaggaaatataaaattgtttaatatccagaagaatctgatatcatcatagtgaagactccatacagacacatgaatgaattatattgtctttaccttgaacttggccttggatatttcaattttcttgttagggagtaattttgtgttttcttgagtgtcacttgataggctatgcatattggaattcaaagaaacccatactctagtcgtttctgcatttcctttaaaaatagcatgggatcatatttaaacaattgttggatagctggaaacagtgtttttaggtcagaccaggcttttggtctttcaaaatttgtgattgaaagcactttagtgacttggattttgtaaatctttcctttcctgcgtttcctttgccatttatttattctttaaaaataaacattttgtggtgtgtttacttttcaaggcactcctctattacacaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:30813 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:30813 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:30813 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
            GeneID:30813 -> Biological process: GO:0007601 [visual perception] evidence: IEA
            GeneID:30813 -> Biological process: GO:0042551 [neuron maturation] evidence: IEA
            GeneID:30813 -> Biological process: GO:0050896 [response to stimulus] evidence: IEA
            GeneID:30813 -> Biological process: GO:0060040 [retinal bipolar neuron differentiation] evidence: IEA
            GeneID:30813 -> Cellular component: GO:0005575 [cellular_component] evidence: ND
            GeneID:30813 -> Cellular component: GO:0005634 [nucleus] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.