GGRNA | NM_014343.2

LOCUS       NM_014343               1384 bp    mRNA    linear   PRI 07-JUL-2013
DEFINITION  Homo sapiens claudin 15 (CLDN15), transcript variant 2, mRNA.
ACCESSION   NM_014343
VERSION     NM_014343.2  GI:297515453
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1384)
  AUTHORS   Smith JG, Avery CL, Evans DS, Nalls MA, Meng YA, Smith EN, Palmer
            C, Tanaka T, Mehra R, Butler AM, Young T, Buxbaum SG, Kerr KF,
            Berenson GS, Schnabel RB, Li G, Ellinor PT, Magnani JW, Chen W, Bis
            JC, Curb JD, Hsueh WC, Rotter JI, Liu Y, Newman AB, Limacher MC,
            North KE, Reiner AP, Quibrera PM, Schork NJ, Singleton AB, Psaty
            BM, Soliman EZ, Solomon AJ, Srinivasan SR, Alonso A, Wallace R,
            Redline S, Zhang ZM, Post WS, Zonderman AB, Taylor HA, Murray SS,
            Ferrucci L, Arking DE, Evans MK, Fox ER, Sotoodehnia N, Heckbert
            SR, Whitsel EA and Newton-Cheh C.
  CONSRTM   CARe and COGENT consortia
  TITLE     Impact of ancestry and common genetic variants on QT interval in
            African Americans
  JOURNAL   Circ Cardiovasc Genet 5 (6), 647-655 (2012)
   PUBMED   23166209
REFERENCE   2  (bases 1 to 1384)
  AUTHORS   Takehara,M., Nishimura,T., Mima,S., Hoshino,T. and Mizushima,T.
  TITLE     Effect of claudin expression on paracellular permeability,
            migration and invasion of colonic cancer cells
  JOURNAL   Biol. Pharm. Bull. 32 (5), 825-831 (2009)
   PUBMED   19420749
REFERENCE   3  (bases 1 to 1384)
  AUTHORS   Lal-Nag,M. and Morin,P.J.
  TITLE     The claudins
  JOURNAL   Genome Biol. 10 (8), 235 (2009)
   PUBMED   19706201
  REMARK    Review article
REFERENCE   4  (bases 1 to 1384)
  AUTHORS   Jovov,B., Orlando,G.S., Tobey,N.A., Brown,K.L., Djukic,Z.,
            Carson,J.L., Brighton,L.E. and Orlando,R.C.
  TITLE     Ion transport and barrier function in a telomerase-immortalized
            human nondysplastic, Barrett's cell line (BAR-T)
  JOURNAL   Dis. Esophagus 22 (5), 386-395 (2009)
   PUBMED   19673046
REFERENCE   5  (bases 1 to 1384)
  AUTHORS   Krause,G., Winkler,L., Mueller,S.L., Haseloff,R.F., Piontek,J. and
            Blasig,I.E.
  TITLE     Structure and function of claudins
  JOURNAL   Biochim. Biophys. Acta 1778 (3), 631-645 (2008)
   PUBMED   18036336
  REMARK    Review article
REFERENCE   6  (bases 1 to 1384)
  AUTHORS   Kiuchi-Saishin,Y., Gotoh,S., Furuse,M., Takasuga,A., Tano,Y. and
            Tsukita,S.
  TITLE     Differential expression patterns of claudins, tight junction
            membrane proteins, in mouse nephron segments
  JOURNAL   J. Am. Soc. Nephrol. 13 (4), 875-886 (2002)
   PUBMED   11912246
REFERENCE   7  (bases 1 to 1384)
  AUTHORS   Tsukita,S., Furuse,M. and Itoh,M.
  TITLE     Multifunctional strands in tight junctions
  JOURNAL   Nat. Rev. Mol. Cell Biol. 2 (4), 285-293 (2001)
   PUBMED   11283726
  REMARK    Review article
REFERENCE   8  (bases 1 to 1384)
  AUTHORS   Heiskala,M., Peterson,P.A. and Yang,Y.
  TITLE     The roles of claudin superfamily proteins in paracellular transport
  JOURNAL   Traffic 2 (2), 93-98 (2001)
   PUBMED   11247307
  REMARK    Review article
REFERENCE   9  (bases 1 to 1384)
  AUTHORS   Yi,X., Wang,Y. and Yu,F.S.
  TITLE     Corneal epithelial tight junctions and their response to
            lipopolysaccharide challenge
  JOURNAL   Invest. Ophthalmol. Vis. Sci. 41 (13), 4093-4100 (2000)
   PUBMED   11095601
REFERENCE   10 (bases 1 to 1384)
  AUTHORS   Kniesel,U. and Wolburg,H.
  TITLE     Tight junctions of the blood-brain barrier
  JOURNAL   Cell. Mol. Neurobiol. 20 (1), 57-76 (2000)
   PUBMED   10690502
  REMARK    Review article
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DN999248.1, AJ245738.1,
            AK056103.1 and AA514265.1.
            On Jun 4, 2010 this sequence version replaced gi:7656980.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. Alternatively spliced transcript variants
            encoding the same protein have been found for this gene. [provided
            by RefSeq, Jun 2010].
            
            Transcript Variant: This variant (2) has a shorter and alternate 5'
            UTR, as compared to variant 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AJ245738.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-111               DN999248.1         7-117
            112-970             AJ245738.1         1-859
            971-1368            AK056103.1         1732-2129
            1369-1384           AA514265.1         1-16                c
FEATURES             Location/Qualifiers
     source          1..1384
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="7"
                     /map="7q11.22"
     gene            1..1384
                     /gene="CLDN15"
                     /note="claudin 15"
                     /db_xref="GeneID:24146"
                     /db_xref="HGNC:2036"
                     /db_xref="HPRD:13065"
     exon            1..582
                     /gene="CLDN15"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    306..308
                     /gene="CLDN15"
                     /note="upstream in-frame stop codon"
     CDS             366..1052
                     /gene="CLDN15"
                     /codon_start=1
                     /product="claudin-15"
                     /protein_id="NP_055158.1"
                     /db_xref="GI:7656981"
                     /db_xref="CCDS:CCDS5717.1"
                     /db_xref="GeneID:24146"
                     /db_xref="HGNC:2036"
                     /db_xref="HPRD:13065"
                     /translation="

MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVYNCWEFPSMLALSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATAGALHILAGICGMVAISWYAFNITRDFFDPLYPGTKYELGPALYLGWSASLISILGGLCLCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV

"
     misc_feature    372..878
                     /gene="CLDN15"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl15797"
                     /db_xref="CDD:210197"
     misc_feature    375..437
                     /gene="CLDN15"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P56746.1);
                     transmembrane region"
     misc_feature    603..665
                     /gene="CLDN15"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P56746.1);
                     transmembrane region"
     misc_feature    615..617
                     /gene="CLDN15"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine; propagated from
                     UniProtKB/Swiss-Prot (P56746.1); phosphorylation site"
     misc_feature    696..698
                     /gene="CLDN15"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (P56746.1); phosphorylation site"
     misc_feature    723..785
                     /gene="CLDN15"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P56746.1);
                     transmembrane region"
     misc_feature    837..899
                     /gene="CLDN15"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P56746.1);
                     transmembrane region"
     exon            583..747
                     /gene="CLDN15"
                     /inference="alignment:Splign:1.39.8"
     exon            748..829
                     /gene="CLDN15"
                     /inference="alignment:Splign:1.39.8"
     exon            830..946
                     /gene="CLDN15"
                     /inference="alignment:Splign:1.39.8"
     exon            947..1370
                     /gene="CLDN15"
                     /inference="alignment:Splign:1.39.8"
     variation       971
                     /gene="CLDN15"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1047319"
     STS             1113..1239
                     /gene="CLDN15"
                     /standard_name="RH102222"
                     /db_xref="UniSTS:96556"
     variation       1186
                     /gene="CLDN15"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:17135342"
     polyA_signal    1346..1351
                     /gene="CLDN15"
     polyA_site      1370
                     /gene="CLDN15"
ORIGIN

ggctccagggtaagtctgccccccccaccctcgtggggcggggagcccggggcagcccagaggctggggggagggggtggacttttggcccgtttcggttattccctccatctcgtcaacagctgccgcgcgcaggcttagctcattcctctgacctgccaggaagcagagagacccacagagcaggagggaggcagaaagtggagacggacctgagcccgaggaagaggcaggcagaggctgaggctgattccaccccagcctgcctggacaaccctccttagccgcagccccttccagttccctaggggttctgcccctccccctctctggggcaccagccccccagggtcctgcatcccaccatgtcgatggctgtggaaacctttggcttcttcatggcaactgtggggctgctgatgctgggggtgactctgccaaacagctactggcgagtgtccactgtgcacgggaacgtcatcaccaccaacaccatcttcgagaacctctggtttagctgtgccaccgactccctgggcgtctacaactgctgggagttcccgtccatgctggccctctctgggtatattcaggcctgccgggcactcatgatcaccgccatcctcctgggcttcctcggcctcttgctaggcatagcgggcctgcgctgcaccaacattgggggcctggagctctccaggaaagccaagctggcggccaccgcaggggccctccacattctggccggtatctgcgggatggtggccatctcctggtacgccttcaacatcacccgggacttcttcgaccccttgtaccccggaaccaagtacgagctgggccccgccctctacctggggtggagcgcctcactgatctccatcctgggtggcctctgcctctgctccgcctgctgctgcggctctgacgaggacccagccgccagcgcccggcggccctaccaggctccagtgtccgtgatgcccgtcgccacctcggaccaagaaggcgacagcagctttggcaaatacggcagaaacgcctacgtgtagcagctctggcccgtgggccccgctgtcttcccactgccccaaggagaggggacctggccggggcccattcccctatagtaacctcaggggccggccacgccccgctcccgtagccccgccccggccacggccccgtgtcttgcactctcatggcccctccaggccaagaactgctcttgggaagtcgcatatctcccctctgaggctggatccctcatcttctgaccctgggttctgggctgtgaaggggacggtgtccccgcacgtttgtattgtgtataaatacattcattaataaatgcatattgtgaccgttcaaaaaaaaaaaaaaa

//

Annotations: