GGRNA Home | Help | Advanced search

2024-04-27 00:47:16, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_014046               1536 bp    mRNA    linear   PRI 07-JUL-2013
DEFINITION  Homo sapiens mitochondrial ribosomal protein S18B (MRPS18B), mRNA.
ACCESSION   NM_014046
VERSION     NM_014046.3  GI:186928836
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1536)
  AUTHORS   Hendrickson,S.L., Lautenberger,J.A., Chinn,L.W., Malasky,M.,
            Sezgin,E., Kingsley,L.A., Goedert,J.J., Kirk,G.D., Gomperts,E.D.,
            Buchbinder,S.P., Troyer,J.L. and O'Brien,S.J.
  TITLE     Genetic variants in nuclear-encoded mitochondrial genes influence
            AIDS progression
  JOURNAL   PLoS ONE 5 (9), E12862 (2010)
   PUBMED   20877624
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1536)
  AUTHORS   Barcellos,L.F., May,S.L., Ramsay,P.P., Quach,H.L., Lane,J.A.,
            Nititham,J., Noble,J.A., Taylor,K.E., Quach,D.L., Chung,S.A.,
            Kelly,J.A., Moser,K.L., Behrens,T.W., Seldin,M.F., Thomson,G.,
            Harley,J.B., Gaffney,P.M. and Criswell,L.A.
  TITLE     High-density SNP screening of the major histocompatibility complex
            in systemic lupus erythematosus demonstrates strong evidence for
            independent susceptibility regions
  JOURNAL   PLoS Genet. 5 (10), E1000696 (2009)
   PUBMED   19851445
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   3  (bases 1 to 1536)
  AUTHORS   Kashuba,E., Yurchenko,M., Yenamandra,S.P., Snopok,B.,
            Isaguliants,M., Szekely,L. and Klein,G.
  TITLE     EBV-encoded EBNA-6 binds and targets MRS18-2 to the nucleus,
            resulting in the disruption of pRb-E2F1 complexes
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 105 (14), 5489-5494 (2008)
   PUBMED   18391203
  REMARK    GeneRIF: EBNA-6 {ebna-3c} binds to MRPS18-2 , and targets it to the
            nucleus; binding targets the small pocket of pRb, which is a site
            of interaction with E2F1. The MRPS18-2 competes with the binding of
            E2F1 to pRb, thereby raising the level of free E2F1
REFERENCE   4  (bases 1 to 1536)
  AUTHORS   Shiina,T., Ota,M., Shimizu,S., Katsuyama,Y., Hashimoto,N.,
            Takasu,M., Anzai,T., Kulski,J.K., Kikkawa,E., Naruse,T., Kimura,N.,
            Yanagiya,K., Watanabe,A., Hosomichi,K., Kohara,S., Iwamoto,C.,
            Umehara,Y., Meyer,A., Wanner,V., Sano,K., Macquin,C., Ikeo,K.,
            Tokunaga,K., Gojobori,T., Inoko,H. and Bahram,S.
  TITLE     Rapid evolution of major histocompatibility complex class I genes
            in primates generates new disease alleles in humans via hitchhiking
            diversity
  JOURNAL   Genetics 173 (3), 1555-1570 (2006)
   PUBMED   16702430
REFERENCE   5  (bases 1 to 1536)
  AUTHORS   Zhang,Z. and Gerstein,M.
  TITLE     Identification and characterization of over 100 mitochondrial
            ribosomal protein pseudogenes in the human genome
  JOURNAL   Genomics 81 (5), 468-480 (2003)
   PUBMED   12706105
REFERENCE   6  (bases 1 to 1536)
  AUTHORS   Suzuki,T., Terasaki,M., Takemoto-Hori,C., Hanada,T., Ueda,T.,
            Wada,A. and Watanabe,K.
  TITLE     Proteomic analysis of the mammalian mitochondrial ribosome.
            Identification of protein components in the 28 S small subunit
  JOURNAL   J. Biol. Chem. 276 (35), 33181-33195 (2001)
   PUBMED   11402041
REFERENCE   7  (bases 1 to 1536)
  AUTHORS   Cavdar Koc,E., Burkhart,W., Blackburn,K., Moseley,A. and
            Spremulli,L.L.
  TITLE     The small subunit of the mammalian mitochondrial ribosome.
            Identification of the full complement of ribosomal proteins present
  JOURNAL   J. Biol. Chem. 276 (22), 19363-19374 (2001)
   PUBMED   11279123
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BP369345.1, BG773408.1,
            AF100761.1 and BE220785.1.
            On Apr 29, 2008 this sequence version replaced gi:16554601.
            
            Summary: Mammalian mitochondrial ribosomal proteins are encoded by
            nuclear genes and help in protein synthesis within the
            mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a
            small 28S subunit and a large 39S subunit. They have an estimated
            75% protein to rRNA composition compared to prokaryotic ribosomes,
            where this ratio is reversed. Another difference between mammalian
            mitoribosomes and prokaryotic ribosomes is that the latter contain
            a 5S rRNA. Among different species, the proteins comprising the
            mitoribosome differ greatly in sequence, and sometimes in
            biochemical properties, which prevents easy recognition by sequence
            homology. This gene encodes a 28S subunit protein that belongs to
            the ribosomal protein S18P family. The encoded protein is one of
            three that has significant sequence similarity to bacterial S18
            proteins. The primary sequences of the three human mitochondrial
            S18 proteins are no more closely related to each other than they
            are to the prokaryotic S18 proteins. Pseudogenes corresponding to
            this gene are found on chromosomes 1q and 2q. [provided by RefSeq,
            Jul 2008].
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF151017.1, AF100761.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            gene product(s) localized to mito. :: reported by MitoCarta
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-103               BP369345.1         1-103
            104-151             BG773408.1         95-142
            152-1527            AF100761.1         7-1382
            1528-1536           BE220785.1         1-9                 c
FEATURES             Location/Qualifiers
     source          1..1536
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="6"
                     /map="6p21.3"
     gene            1..1536
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /note="mitochondrial ribosomal protein S18B"
                     /db_xref="GeneID:28973"
                     /db_xref="HGNC:14516"
                     /db_xref="HPRD:14781"
                     /db_xref="MIM:611982"
     exon            1..235
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /inference="alignment:Splign:1.39.8"
     variation       57
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142627502"
     variation       110
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146036133"
     variation       118
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377027469"
     variation       124
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369817736"
     variation       137
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17189183"
     variation       142
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199867691"
     variation       147
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200725313"
     CDS             158..934
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /note="mitochondrial ribosomal protein S18-2; S18mt-b;
                     mrps18-b; MRP-S18-b; 28S ribosomal protein S18-2,
                     mitochondrial"
                     /codon_start=1
                     /product="28S ribosomal protein S18b, mitochondrial"
                     /protein_id="NP_054765.1"
                     /db_xref="GI:7662645"
                     /db_xref="CCDS:CCDS4682.1"
                     /db_xref="GeneID:28973"
                     /db_xref="HGNC:14516"
                     /db_xref="HPRD:14781"
                     /db_xref="MIM:611982"
                     /translation="
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL
"
     misc_feature    482..646
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /note="Ribosomal protein S18; Region: Ribosomal_S18;
                     pfam01084"
                     /db_xref="CDD:201589"
     variation       161
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:137926274"
     variation       162
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375661910"
     variation       183
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:368332564"
     variation       191
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372011234"
     variation       197
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140942217"
     variation       198
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:144600886"
     variation       205
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:138552206"
     variation       206
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11555739"
     variation       209
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:116707717"
     exon            236..344
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /inference="alignment:Splign:1.39.8"
     variation       292
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35115248"
     variation       293
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373782294"
     variation       297
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150787623"
     variation       320
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149504170"
     exon            345..442
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /inference="alignment:Splign:1.39.8"
     variation       361
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147201268"
     variation       369
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140805833"
     variation       373
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188820794"
     variation       374
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144768627"
     variation       389
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147483597"
     variation       423
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113079348"
     variation       429
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148496697"
     exon            443..511
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /inference="alignment:Splign:1.39.8"
     variation       444
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199725053"
     variation       445
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:115237884"
     variation       505
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367682122"
     exon            512..578
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /inference="alignment:Splign:1.39.8"
     variation       515
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116524936"
     variation       532
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200282715"
     variation       542
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371898376"
     variation       549
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:55637991"
     variation       561
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:114474320"
     variation       564
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200954069"
     exon            579..638
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /inference="alignment:Splign:1.39.8"
     variation       602
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151108350"
     variation       603
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141114241"
     exon            639..1534
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /inference="alignment:Splign:1.39.8"
     variation       696
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146860483"
     variation       728
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372687363"
     variation       743
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17849985"
     variation       783
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140902930"
     variation       784
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145393589"
     variation       801
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144633864"
     variation       806
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376095160"
     variation       838
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201762194"
     variation       844
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148815125"
     variation       845
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:34315095"
     variation       870
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372681182"
     variation       882
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:116693618"
     variation       888
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148828689"
     variation       966
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:377043280"
     variation       1017
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:142489658"
     variation       1028
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:183236532"
     variation       1090
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:187747154"
     variation       1129
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201971528"
     variation       1151
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:192259088"
     variation       1167
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371876825"
     variation       1225
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374097554"
     variation       1233..1234
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:35997671"
     variation       1245..1248
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace=""
                     /replace="aaaa"
                     /db_xref="dbSNP:368057496"
     variation       1247..1248
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace=""
                     /replace="aa"
                     /db_xref="dbSNP:71767101"
     variation       1249..1250
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:71552012"
     variation       1289
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146455019"
     variation       1342
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75407659"
     STS             1347..1476
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /standard_name="RH102456"
                     /db_xref="UniSTS:96790"
     variation       1351
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372073637"
     variation       1398
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376685424"
     variation       1427
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369731283"
     variation       1462
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111850078"
     variation       1487
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112418429"
     polyA_signal    1506..1511
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
     polyA_site      1526
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
     polyA_site      1527
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
     variation       1529
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:111609724"
     polyA_site      1532
                     /gene="MRPS18B"
                     /gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
                     MRPS18-2; PTD017; S18amt"
ORIGIN      
agcttctcccccatgccttccctttcacgcttccgtcctgacgcaaacgtggggccgccttccgcactgcgggcttgtccttggccctgccctactcagtttcctgaagcatgcgcagttgcctttccgtcaattcctgtcctgggcgtacgtcaagatggcggcgtctgtattaaacaccgtgctgaggcggcttcctatgctatctctcttccgaggttctcacagagttcaggttcccctccagactctttgcaccaaagctccctctgaggaagattctttgtcctcagttcccatttctccttataaggatgagccctggaaatatctggaatcagaagaataccaggagcgatatggttctcgccccgtctgggctgactaccgccgcaaccacaagggtggtgtacccccacagcggactcggaagacatgtattcgtcggaataaagttgttgggaatccctgccccatctgtcgagatcacaagttgcatgttgactttaggaacgtgaagctcttggagcaatttgtctgcgcccacacgggtatcatcttctatgctccatacacaggagtctgtgtgaagcagcacaagcggttgacccaggccatccagaaagccagggatcatggtctcctcatttaccacatcccccaggttgaaccacgggaccttgacttcagtacctctcatggggctgtgagtgctactccgccagcccccaccctggtctcaggtgacccctggtacccatggtacaactggaaacagccaccggagagagaactgtctcgccttcgccggctttaccagggtcatctccaagaagagagtggccccccacctgagtcaatgcccaagatgccccctagaacaccagcggaagcctcctccactgggcagacaggccctcagagtgctctgtaggagctgtagactgggaagagaggccaggcgtggtggctcactcctgtaatcccagcactttgggaagccaaggtgggctgatcacttgatcccaggagtttgagaccagcctgggcaccatggtgaaacctcgtctttaccaaaaaatacaaaaattagctgggtgtggtggtgcacacctgtagtctcaactattggggaggctaaggtaggatcacttgatcccaggaggcggaggttgcagtgagttgcagtcacacccctgcactccagcctgggtgacagctagaccctgtctcaaaaaaaaaaaaaaagactgggaagagagctagagggactaggagataatgtgtatgtaggtttatgtgatgggatatcaccctgaagagttgtgtcttttgtggccagtgacaaatccaggaaatgaatgttgctgatagggataaatcttgaggctgagggcgggtggtacagatgtgtatgggaaaccccaacccctatatattgtaaatagatgggctgggctaaacattgttgccgtttcatacttctaccaactcagcttttacacaataaagctctactgtctctggtttgcttaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:28973 -> Molecular function: GO:0003735 [structural constituent of ribosome] evidence: NAS
            GeneID:28973 -> Biological process: GO:0006412 [translation] evidence: NAS
            GeneID:28973 -> Cellular component: GO:0005763 [mitochondrial small ribosomal subunit] evidence: NAS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.