LOCUS       NM_006984               2490 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens claudin 10 (CLDN10), transcript variant b, mRNA.
ACCESSION   NM_006984
VERSION     NM_006984.4  GI:231569108
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2490)
  AUTHORS   Huang,G.W., Ding,X., Chen,S.L. and Zeng,L.
  TITLE     Expression of claudin 10 protein in hepatocellular carcinoma:
            impact on survival
  JOURNAL   J. Cancer Res. Clin. Oncol. 137 (8), 1213-1218 (2011)
   PUBMED   21647678
  REMARK    GeneRIF: Claudin 10 protein is highly expressed in hepatocellular
            carcinoma (HCC) tissue and is closely related to angiogenesis. It
            could be a useful marker to predict poor prognosis of HCC patients
            after hepatectomy.
REFERENCE   2  (bases 1 to 2490)
  AUTHORS   Merikallio,H., Paakko,P., Harju,T. and Soini,Y.
  TITLE     Claudins 10 and 18 are predominantly expressed in lung
            adenocarcinomas and in tumors of nonsmokers
  JOURNAL   Int J Clin Exp Pathol 4 (7), 667-673 (2011)
   PUBMED   22076167
  REMARK    GeneRIF: Claudin 10/18 are most commonly expressed in lung
            adenocarcinomas. Female patients and non-smokers express these
            claudins more commonly suggesting that they may play a part in the
            carcinogenesis of tobacco unrelated carcinoma.
REFERENCE   3  (bases 1 to 2490)
  AUTHORS   Seo,H.W., Rengaraj,D., Choi,J.W., Ahn,S.E., Song,Y.S., Song,G. and
            Han,J.Y.
  TITLE     Claudin 10 is a glandular epithelial marker in the chicken model as
            human epithelial ovarian cancer
  JOURNAL   Int. J. Gynecol. Cancer 20 (9), 1465-1473 (2010)
   PUBMED   21370593
  REMARK    GeneRIF: CLDN10 is a novel biomarker for detecting ovarian cancer
            in the chicken, a suitable animal model for investigating the
            effect and function of CLDN in human ovarian cancer.
REFERENCE   4  (bases 1 to 2490)
  AUTHORS   Ouban,A. and Ahmed,A.A.
  TITLE     Claudins in human cancer: a review
  JOURNAL   Histol. Histopathol. 25 (1), 83-90 (2010)
   PUBMED   19924644
  REMARK    Review article
REFERENCE   5  (bases 1 to 2490)
  AUTHORS   Lal-Nag,M. and Morin,P.J.
  TITLE     The claudins
  JOURNAL   Genome Biol. 10 (8), 235 (2009)
   PUBMED   19706201
  REMARK    Review article
REFERENCE   6  (bases 1 to 2490)
  AUTHORS   Christian,S.L., McDonough,J., Liu Cy,C.Y., Shaikh,S., Vlamakis,V.,
            Badner,J.A., Chakravarti,A. and Gershon,E.S.
  TITLE     An evaluation of the assembly of an approximately 15-Mb region on
            human chromosome 13q32-q33 linked to bipolar disorder and
            schizophrenia
  JOURNAL   Genomics 79 (5), 635-656 (2002)
   PUBMED   11991713
REFERENCE   7  (bases 1 to 2490)
  AUTHORS   Tsukita,S., Furuse,M. and Itoh,M.
  TITLE     Multifunctional strands in tight junctions
  JOURNAL   Nat. Rev. Mol. Cell Biol. 2 (4), 285-293 (2001)
   PUBMED   11283726
  REMARK    Review article
REFERENCE   8  (bases 1 to 2490)
  AUTHORS   Heiskala,M., Peterson,P.A. and Yang,Y.
  TITLE     The roles of claudin superfamily proteins in paracellular transport
  JOURNAL   Traffic 2 (2), 93-98 (2001)
   PUBMED   11247307
  REMARK    Review article
REFERENCE   9  (bases 1 to 2490)
  AUTHORS   Kniesel,U. and Wolburg,H.
  TITLE     Tight junctions of the blood-brain barrier
  JOURNAL   Cell. Mol. Neurobiol. 20 (1), 57-76 (2000)
   PUBMED   10690502
  REMARK    Review article
REFERENCE   10 (bases 1 to 2490)
  AUTHORS   Kubota,K., Furuse,M., Sasaki,H., Sonoda,N., Fujita,K., Nagafuchi,A.
            and Tsukita,S.
  TITLE     Ca(2+)-independent cell-adhesion activity of claudins, a family of
            integral membrane proteins localized at tight junctions
  JOURNAL   Curr. Biol. 9 (18), 1035-1038 (1999)
   PUBMED   10508613
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DA133712.1, BC010920.1,
            AK055855.1, BG697724.1 and DB544708.1.
            On May 12, 2009 this sequence version replaced gi:38570070.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. The expression level of this gene is
            associated with recurrence of primary hepatocellular carcinoma. Six
            alternatively spliced transcript variants encoding different
            isoforms have been reported, but the transcript sequences of some
            variants are not determined.[provided by RefSeq, Jun 2010].
            
            Transcript Variant: This variant (b) differs in the 5' UTR and 5'
            coding region, representing use of an alternate promoter, compared
            to variant a. The resulting isoform (b) has a longer and distinct
            N-terminus, compared to isoform a.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC010920.1, U89916.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025082, ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-32                DA133712.1         1-32
            33-976              BC010920.1         5-948
            977-1710            AK055855.1         1140-1873
            1711-1711           BG697724.1         197-197
            1712-2183           AK055855.1         1875-2346
            2184-2184           BG697724.1         669-669
            2185-2386           AK055855.1         2348-2549
            2387-2490           DB544708.1         335-438
FEATURES             Location/Qualifiers
     source          1..2490
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="13"
                     /map="13q31-q34"
     gene            1..2490
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /note="claudin 10"
                     /db_xref="GeneID:9071"
                     /db_xref="HGNC:2033"
                     /db_xref="HPRD:13063"
     exon            1..281
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /inference="alignment:Splign:1.39.8"
     CDS             62..748
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /note="isoform b precursor is encoded by transcript
                     variant b; claudin-10; OSP-like protein"
                     /codon_start=1
                     /product="claudin-10 isoform b precursor"
                     /protein_id="NP_008915.1"
                     /db_xref="GI:5921465"
                     /db_xref="CCDS:CCDS9476.1"
                     /db_xref="GeneID:9071"
                     /db_xref="HGNC:2033"
                     /db_xref="HPRD:13063"
                     /translation="

MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV

"
     sig_peptide     62..130
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    62..124
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P78369.2);
                     transmembrane region"
     misc_feature    71..598
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; pfam00822"
                     /db_xref="CDD:109862"
     misc_feature    302..364
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P78369.2);
                     transmembrane region"
     misc_feature    407..469
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P78369.2);
                     transmembrane region"
     misc_feature    542..604
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P78369.2);
                     transmembrane region"
     exon            282..443
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /inference="alignment:Splign:1.39.8"
     exon            444..525
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /inference="alignment:Splign:1.39.8"
     exon            526..633
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /inference="alignment:Splign:1.39.8"
     exon            634..2490
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /inference="alignment:Splign:1.39.8"
     STS             649..832
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /standard_name="CLDN10"
                     /db_xref="UniSTS:505369"
     STS             761..945
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /standard_name="RH13730"
                     /db_xref="UniSTS:61949"
     STS             761..881
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /standard_name="RH71267"
                     /db_xref="UniSTS:46842"
     polyA_signal    951..956
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
     polyA_site      972
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
     STS             1000..1227
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /standard_name="D13S1156"
                     /db_xref="UniSTS:11282"
     STS             1073..1227
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /standard_name="D13S846E"
                     /db_xref="UniSTS:151518"
     variation       complement(1471)
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1952106"
     polyA_signal    2470..2475
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
ORIGIN      

gagtgcgggggtcgcggcgcagagtgggagccggagagcgagcgcggctgcagccggcggcatggctagcacggcttcggagatcatcgccttcatggtctccatctcaggctgggtactggtgtcctccacgctgcccaccgactactggaaggtgtctaccatcgacggcacggtcatcacaaccgccacctattgggccaacctgtggaaggcgtgcgttaccgactccacgggcgtctccaactgcaaggacttcccctccatgctggcgctggacggttatatacaggcatgtagaggacttatgatcgctgctgtcagcctgggcttctttggttccatatttgcgctctttggaatgaagtgtaccaaagtcggaggctccgataaagccaaagctaaaattgcttgtttggctgggattgtattcatactgtcagggctgtgctcaatgactggatgttccctatatgcaaacaaaatcacaacggaattctttgatcctctctttgttgagcaaaagtatgaattaggagccgctctgtttattggatgggcaggagcctcactgtgcataattggtggtgtcatattttgcttttcaatatctgacaacaacaaaacacccagatacacatacaacggggccacatctgtcatgtcttctcggacaaagtatcatggtggagaagattttaaaacaacaaacccttcaaaacagtttgataaaaatgcttatgtctaaaagagctcgctggcaagctgcctcttgagtttgttataaaagcgaactgttcacaaaatgatcccatcaaggccctcccataattaacactcaaaactatttttaaaatatgcatttgaagcatctgttgattgtatggatgtaagtgttcttacatagttagttatatactaatcattttctgttgtggctttctataaaaaataaacagtttatttacaggatttgtaaaatgttttctacatttatatagaacatgaaaagcatttagtaccaaaggttcaagaagtattcgtactctagcctttttaatcattcatagatagaagtctttgtacccactccttatgtttcttttcattcataaacaggtgtataaggaacaatgtcttataaacagcatgggggcaatctgagaatattcctcaaaaggtgtccaggttaaatagacatgttactggctgcacacaggcaaattctagtttgttttttttaagtattctacaacatttatttaaaaaggtaaatctttttgttgaagcagcaagttatctggtagaacttaacttctacaggatcagagaggatcttgctcattcatggccatatccacatgcccatggccactcagtagattgttgaaaaagcaaagccacaccattctctttgatgtatgcagagagttacgtagcaggggatgttctctgatttattccactggcaccattagtgaatatttagttgttttcataaacgatgctgtgatgaagactcatgtacatatttagcaaattttggtttcttacatgtgcctgtcatgactgtaattcattatgactgctccaggaagggctaatggggccaatatattattgcctgtcatgtggcacatccatgttaaggggctgaggcgtccctggcacggaatgcagagccctgagctagggcatcagcagaagctgagatagagatattggtcatggttgactgaggagccaattaaaacctgtttatgcctagtgttccattattggaacactaagcatgtgggagttatttatatcctactgctcaaggtcatcgccaaggtgtgattggaaaaattcaaaaaattgcaacctcaggcataaatgggttaaggacatcccaagcccaagtggtacgtgcctcactcagaactgacgggccgagttctatctaggtgtgtcttccagaacctgtttacggctaactggataactgagagacttgtcatttctaaagacatttaagttgctccagggatttctgaaaaaagacacaggcttcttcctagagccagccctatataacatgcccacaagggcaacagttatcacagttcatacacacctttcatgtcctgtctcactcactcctcacagccatcctaggagatacatattgttttcatcctgcatttacagaaaaagaaatgaaaacagagagcttaaataatttgccacagtaatgtcgaaactaggcctttgaaccaaggcagtctagggtaaaatatagtttcaaagtatgaataagaattggtatttgtgttatctttgagtaagaaactgtccgatatgaatcacaacgtgggtgaatgtagtattttcctgaagtgtgaaagacttaaaaaaaagaatcacattgttcagaggtgctcaatggaaagaaaaggaaatgaacaagtttgttaaaagataaaaaataaaaaaaattccatacct

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:9071 -> Molecular function: GO:0005198 [structural molecule activity] evidence: IEA
            GeneID:9071 -> Molecular function: GO:0042802 [identical protein binding] evidence: ISS
            GeneID:9071 -> Biological process: GO:0007155 [cell adhesion] evidence: TAS
            GeneID:9071 -> Biological process: GO:0016338 [calcium-independent cell-cell adhesion] evidence: ISS
            GeneID:9071 -> Cellular component: GO:0005886 [plasma membrane] evidence: IEA
            GeneID:9071 -> Cellular component: GO:0005923 [tight junction] evidence: ISS
            GeneID:9071 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA