GGRNA | NM_006237.3

LOCUS       NM_006237               3817 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens POU class 4 homeobox 1 (POU4F1), mRNA.
ACCESSION   NM_006237 XM_001127734 XM_001133287
VERSION     NM_006237.3  GI:110347448
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3817)
  AUTHORS   Faryna,M., Konermann,C., Aulmann,S., Bermejo,J.L., Brugger,M.,
            Diederichs,S., Rom,J., Weichenhan,D., Claus,R., Rehli,M.,
            Schirmacher,P., Sinn,H.P., Plass,C. and Gerhauser,C.
  TITLE     Genome-wide methylation screen in low-grade breast cancer
            identifies novel epigenetically altered genes as potential
            biomarkers for tumor diagnosis
  JOURNAL   FASEB J. 26 (12), 4937-4950 (2012)
   PUBMED   22930747
  REMARK    GeneRIF: Data indicate that median methylation levels of BCAN,
            HOXD1, KCTD8, KLF11, NXPH1, POU4F1, SIM1, and TCF7L1 were >/=30%
            higher than in normal samples, representing potential biomarkers
            for tumor diagnosis.
REFERENCE   2  (bases 1 to 3817)
  AUTHORS   Dunne,J., Mannari,D., Farzaneh,T., Gessner,A., van Delft,F.W.,
            Heidenreich,O., Young,B.D. and Gascoyne,D.M.
  TITLE     AML1/ETO and POU4F1 synergy drives B-lymphoid gene expression
            typical of t(8;21) acute myeloid leukemia
  JOURNAL   Leukemia 26 (5), 1131-1135 (2012)
   PUBMED   22064348
  REMARK    GeneRIF: PoU4F1 is highly expressed in t(8;21) samples, with
            AML/ETO appearning to promote some BRN3A expression
REFERENCE   3  (bases 1 to 3817)
  AUTHORS   Das Purkayastha,B.P. and Roy,J.K.
  TITLE     Molecular analysis of oncogenicity of the transcription factor,
            BRN3A, in cervical cancer cells
  JOURNAL   J. Cancer Res. Clin. Oncol. 137 (12), 1859-1867 (2011)
   PUBMED   21928122
  REMARK    GeneRIF: BRN3A possesses anti-apoptotic property, and considering
            the above results, it may be regarded as the key component in
            promoting tumorigenic growth in the uterine cervical cells.
REFERENCE   4  (bases 1 to 3817)
  AUTHORS   Fortier,J.M., Payton,J.E., Cahan,P., Ley,T.J., Walter,M.J. and
            Graubert,T.A.
  TITLE     POU4F1 is associated with t(8;21) acute myeloid leukemia and
            contributes directly to its unique transcriptional signature
  JOURNAL   Leukemia 24 (5), 950-957 (2010)
   PUBMED   20376082
  REMARK    GeneRIF: Dysregulation of POU4F1 is associated with t(8;21) acute
            myeloid leukemia.
REFERENCE   5  (bases 1 to 3817)
  AUTHORS   Smith,M.D., Dawson,S.J. and Latchman,D.S.
  TITLE     Inhibition of neuronal process outgrowth and neuronal specific gene
            activation by the Brn-3b transcription factor
  JOURNAL   J. Biol. Chem. 272 (2), 1382-1388 (1997)
   PUBMED   8995448
REFERENCE   6  (bases 1 to 3817)
  AUTHORS   Still,I.H. and Cowell,J.
  TITLE     The Brn-3a transcription factor gene (POU4F1) maps close to the
            locus for the variant late infantile form of neuronal
            ceroid-lipofuscinosis
  JOURNAL   Cytogenet. Cell Genet. 74 (3), 225-226 (1996)
   PUBMED   8941380
REFERENCE   7  (bases 1 to 3817)
  AUTHORS   Xiang,M., Zhou,L., Macke,J.P., Yoshioka,T., Hendry,S.H., Eddy,R.L.,
            Shows,T.B. and Nathans,J.
  TITLE     The Brn-3 family of POU-domain factors: primary structure, binding
            specificity, and expression in subsets of retinal ganglion cells
            and somatosensory neurons
  JOURNAL   J. Neurosci. 15 (7 PT 1), 4762-4785 (1995)
   PUBMED   7623109
REFERENCE   8  (bases 1 to 3817)
  AUTHORS   Gerrero,M.R., McEvilly,R.J., Turner,E., Lin,C.R., O'Connell,S.,
            Jenne,K.J., Hobbs,M.V. and Rosenfeld,M.G.
  TITLE     Brn-3.0: a POU-domain protein expressed in the sensory, immune, and
            endocrine systems that functions on elements distinct from known
            octamer motifs
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 90 (22), 10841-10845 (1993)
   PUBMED   8248179
REFERENCE   9  (bases 1 to 3817)
  AUTHORS   Bhargava,A.K., Li,Z. and Weissman,S.M.
  TITLE     Differential expression of four members of the POU family of
            proteins in activated and phorbol 12-myristate 13-acetate-treated
            Jurkat T cells
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 90 (21), 10260-10264 (1993)
   PUBMED   8234287
REFERENCE   10 (bases 1 to 3817)
  AUTHORS   Collum,R.G., Fisher,P.E., Datta,M., Mellis,S., Thiele,C.,
            Huebner,K., Croce,C.M., Israel,M.A., Theil,T., Moroy,T. et al.
  TITLE     A novel POU homeodomain gene specifically expressed in cells of the
            developing mammalian nervous system
  JOURNAL   Nucleic Acids Res. 20 (18), 4919-4925 (1992)
   PUBMED   1357630
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from L20433.1, AL445209.4,
            BM714015.1, N74107.1 and BM726529.1.
            On or before Nov 22, 2006 this sequence version replaced
            gi:113424090, gi:113424417, gi:20127494.
            
            Summary: This gene encodes a member of the POU-IV class of neural
            transcription factors. This protein is expressed in a subset of
            retinal ganglion cells and may be involved in the developing
            sensory nervous system. This protein may also promote the growth of
            cervical tumors. A translocation of this gene is associated with
            some adult acute myeloid leukemias. [provided by RefSeq, Mar 2012].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: L20433.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025089 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-720               L20433.1           1-720
            721-940             AL445209.4         119191-119410       c
            941-2341            L20433.1           944-2344
            2342-2343           AL445209.4         117788-117789       c
            2344-3477           L20433.1           2347-3480
            3478-3727           BM714015.1         153-402
            3728-3742           N74107.1           1-15                c
            3743-3817           BM726529.1         1-75
FEATURES             Location/Qualifiers
     source          1..3817
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="13"
                     /map="13q31.1"
     gene            1..3817
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
                     /note="POU class 4 homeobox 1"
                     /db_xref="GeneID:5457"
                     /db_xref="HGNC:9218"
                     /db_xref="MIM:601632"
     exon            1..357
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
                     /inference="alignment:Splign:1.39.8"
     STS             9..1643
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
                     /db_xref="UniSTS:484695"
     STS             214..1551
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
                     /db_xref="UniSTS:495219"
     STS             228..380
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
                     /standard_name="Pou4f1"
                     /db_xref="UniSTS:254228"
     CDS             235..1494
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
                     /note="brain-3A; homeobox/POU domain protein RDC-1;
                     brain-specific homeobox/POU domain protein 3A"
                     /codon_start=1
                     /product="POU domain, class 4, transcription factor 1"
                     /protein_id="NP_006228.3"
                     /db_xref="GI:110347449"
                     /db_xref="CCDS:CCDS31996.1"
                     /db_xref="GeneID:5457"
                     /db_xref="HGNC:9218"
                     /db_xref="MIM:601632"
                     /translation="

MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHSLGHLSHPAAAAAMNMPSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY

"
     misc_feature    403..432
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q01851.4);
                     Region: POU-IV box"
     misc_feature    1012..1245
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
                     /note="Found in Pit-Oct-Unc transcription factors; Region:
                     POU; smart00352"
                     /db_xref="CDD:197673"
     misc_feature    1300..1476
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(1300..1314,1318..1320,1369..1371,1387..1389,
                     1426..1428,1432..1437,1444..1449,1453..1461,1465..1470)
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(1306..1308,1315..1317,1435..1437,1444..1449,
                     1456..1458)
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     exon            358..3817
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    1028..1466
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
                     /note="label: POU"
     STS             1197..1470
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
                     /standard_name="PMC125354P1"
                     /db_xref="UniSTS:270492"
     STS             2249..2425
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
                     /standard_name="RH70862"
                     /db_xref="UniSTS:63339"
     STS             3332..3568
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
                     /standard_name="RH17633"
                     /db_xref="UniSTS:71511"
     variation       3408
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200107331"
     polyA_signal    3712..3717
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
     polyA_site      3737
                     /gene="POU4F1"
                     /gene_synonym="brn-3A; BRN3A; Oct-T1; RDC-1"
ORIGIN

gcggggctagagctgtcggagaagcgggaccgcgaggccggcgcgcggcgctctgcgcggtcagagggagcgcctggcagcagcaggagcagcagcagcagcccgcggcggggccgccgccagccgccgcgaccgccgcggctgcagcctccgaagggaggccgggtgagccggcgtacgcactttcccgcggactttcggagtgtttgtggatatacatgccaagccgccacgatgatgtccatgaacagcaagcagcctcactttgccatgcatcccaccctccctgagcacaagtacccgtcgctgcactccagctccgaggccatccggcgggcctgcctgcccacgccgccgctgcagagcaacctcttcgccagcctggacgagacgctgctggcgcgggccgaggcgctggcggccgtggacatcgccgtgtcccagggcaagagccatcctttcaagccggacgccacgtaccacacgatgaacagcgtgccgtgcacgtccacttccacggtgcctctggcgcaccaccaccaccaccaccaccaccaccaggcgctcgaacccggcgatctgctggaccacatctcctcgccgtcgctcgcgctcatggccggcgcgggcggcgcgggcgcggcggccggcggcggcggcgcccacgacggcccggggggcggtggcggcccgggcggcggcggcggcccgggcggcggccccgggggaggcggcggtggcggcccggggggcggcggcggcggcccgggcggcgggctcctgggcggctccgcgcaccctcacccgcatatgcacagcctgggccacctgtcgcaccccgcggcggcggccgccatgaacatgccgtccgggctgccgcaccccgggctggtggcggcggcggcgcaccacggcgcggcagcggcagcggcggcggcggcggccgggcaggtggcagcggcatcggcggcggcggccgtggtgggcgcagcgggcctggcgtccatctgcgactcggacacggacccgcgcgagctcgaggcgttcgcggagcgcttcaagcagcggcgcatcaagctgggcgtgacgcaggccgacgtgggctcggcgctggccaacctcaagatcccgggcgtgggctcactcagccagagcaccatctgcaggttcgagtcgctcacgctctcgcacaacaacatgatcgcgctcaagcccatcctgcaggcgtggctcgaggaggccgagggcgcccagcgcgagaaaatgaacaagcctgagctcttcaacggcggcgagaagaagcgcaagcggacttccatcgccgcgcccgagaagcgctccctcgaggcctacttcgccgtgcagccccggccctcgtccgagaagatcgccgccatcgccgagaaactggacctcaaaaagaacgtggtgcgggtgtggttttgcaaccagagacagaagcagaagcggatgaaattctctgccacttactgagggggctgggaggtgtcgggcgggacagaatggggagctgaggaggcatttttggggggctttcctctgcttgcctcccctcggatttggagtgtccgttatcctgcctgcatttggggagtcccttctcgctctctttcctccacccattctctgattttcctgcctttgctgtcccctagccttgaggactggggtgctgggtgtggggattggagtatagggtaggggagaagggggggagcattcgggggagtggggagtggggggaaggaaagcggagacccgagcaggggttttaaggagcaggatggttctggggtttgggtggggggagacgcgggaagggtaggaaaatggactgtttctgaccagagacacttacctaaatatcctggggaccaaggaactatgtacaaaaacaaacctaccaaccaccaaaaactagacaaataaagacaaactaaaacaaaacagaacaaaagcaaaggaaaatgctttagaaattttaactccggggagccataatctgcaacttcattttcccccatagaagagaaaaaagagcaccaccattattaccacctccccaaccctacacgcacgaactgagtcgaaaaacgaaaaccaaacgagcgagaagttgaagttctgggtatcaaagctagttgttctgtctgcgtgtttaatttttccctctctcacctccaccccatccatatcctctttatttcctccgttccaatgagaggcctatggctgctctccaatcccgggaagtgagtgggagcacagctgaaaagagagggtcagggggaggctggctgcttgcttaggtggaatccaagttttcccgtggccctgcctatactctggtggcctggtcctgttggggtgggggtctttggagagaagggcatagtctttgagctactaaaaagcagaattccggagcttcgagatatcttattctaggaaaatgaaacaattttaacaacagttttttttcctcttatgtcgaagatctagttttagacaatttcaaaataagcttttcccactcatagaactttaacttgccctttcagttttatcttttttttagagagaggtttaaactactgatttttcctgttgattcaaatagactaatggggtgaaagttattaggagagatactctctcctgttttctccactgaacgagactcatcttgctcttctaggtcccgtttcttcctctcttggaggacatgaaattatagaaatgttgagaagttcctgctttcttttgcggtaggacttggctgtgagaaaatcacctaaatcccagaaaagaggaagacagatttaaagtgcccccacccccatttgtttcaaagaggtctgcatgttgggcgaaaacagaacaactgtgtttccttttacttgttcttattattcaagagtcatttattacaggggataaatgttgggtagcaagaactttaatttgcactaccagtctcccaaatagaaaatcatgtatagtatttcatagtaataatcaggtaccttacaagctgctggtggattttaaaaaattaagatagttgaaggtggttaggtaaaatgcctgctttgtgtacaagatactctttggatctctcgtagagatggtttgttaccatcctttaatcataactaaaacattgaaaacagaacaaatgagaaaagaaaaaaaacctgccgattaacaagactgaaatcatgcatgatctgaaaggtgtggaaagaaacacaattaggtctcactctggttaggcattatttatttaattatgttgtatatcattgtttgcagggcaaacattctatgcatttgaaactgagcactaaactgggctagctttctggtagaccgttttgtggctagtgcgatttcacagtctactgcctgtttccactgaaaacatttttgtcatattcttgtattcaaagaaaaaggaaaaaagattattgtaaatattttatttaatgcacacattcacacagtggtaacagactgccagtgttcatcctgaaatgtctcacggattgatctacctgtccatgtatgtctgctgagctttctccttggttatgttttttctcttttacctttctcctcccttacttctatcagaaccaattctatgcgccaaaatacaacagggggatgtgtcccagtacacttacaaataaaacataactgaaagaagagcagttttatgatttgggtgcgtttttgtgtttatactgggccaggtcctggtagaacctttcaacaaacaaccaaacaaaaa

//

Annotations: