GGRNA Home | Help | Advanced search

2024-04-27 09:39:57, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_004356               1497 bp    mRNA    linear   PRI 26-MAY-2013
DEFINITION  Homo sapiens CD81 molecule (CD81), mRNA.
ACCESSION   NM_004356
VERSION     NM_004356.3  GI:62240999
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1497)
  AUTHORS   Davis,C., Harris,H.J., Hu,K., Drummer,H.E., McKeating,J.A.,
            Mullins,J.G. and Balfe,P.
  TITLE     In silico directed mutagenesis identifies the CD81/claudin-1
            hepatitis C virus receptor interface
  JOURNAL   Cell. Microbiol. 14 (12), 1892-1903 (2012)
   PUBMED   22897233
  REMARK    GeneRIF: Fluorescent Resonance Energy Transfer studies confirm a
            role for these CD81 residues in claudin-1 association and Hepatitis
            C virus infection.
REFERENCE   2  (bases 1 to 1497)
  AUTHORS   Diao,J., Pantua,H., Ngu,H., Komuves,L., Diehl,L., Schaefer,G. and
            Kapadia,S.B.
  TITLE     Hepatitis C virus induces epidermal growth factor receptor
            activation via CD81 binding for viral internalization and entry
  JOURNAL   J. Virol. 86 (20), 10935-10949 (2012)
   PUBMED   22855500
  REMARK    GeneRIF: data demonstrate that EGFR internalization is critical for
            hepatitis C virus entry and identify a hitherto-unknown association
            between CD81 and EGFR
REFERENCE   3  (bases 1 to 1497)
  AUTHORS   Rajesh,S., Sridhar,P., Tews,B.A., Feneant,L., Cocquerel,L.,
            Ward,D.G., Berditchevski,F. and Overduin,M.
  TITLE     Structural basis of ligand interactions of the large extracellular
            domain of tetraspanin CD81
  JOURNAL   J. Virol. 86 (18), 9606-9616 (2012)
   PUBMED   22740401
  REMARK    GeneRIF: A novel membrane binding interface was revealed adjacent
            to the exposed HCV interaction site in the extracellular loop of
            CD81.
REFERENCE   4  (bases 1 to 1497)
  AUTHORS   Zhu,Y.Z., Luo,Y., Cao,M.M., Liu,Y., Liu,X.Q., Wang,W., Wu,D.G.,
            Guan,M., Xu,Q.Q., Ren,H., Zhao,P. and Qi,Z.T.
  TITLE     Significance of palmitoylation of CD81 on its association with
            tetraspanin-enriched microdomains and mediating hepatitis C virus
            cell entry
  JOURNAL   Virology 429 (2), 112-123 (2012)
   PUBMED   22560863
  REMARK    GeneRIF: These results suggest that palmitoylation of CD81 should
            facilitate hepatitis C virus entry, at least in part, by regulating
            the association of CD81 with tetraspanin-enriched microdomains.
REFERENCE   5  (bases 1 to 1497)
  AUTHORS   Cevik,S.I., Keskin,N., Belkaya,S., Ozlu,M.I., Deniz,E.,
            Tazebay,U.H. and Erman,B.
  TITLE     CD81 interacts with the T cell receptor to suppress signaling
  JOURNAL   PLoS ONE 7 (11), E50396 (2012)
   PUBMED   23226274
  REMARK    GeneRIF: CD81 interacts with the T cell receptor to suppress
            signaling.
REFERENCE   6  (bases 1 to 1497)
  AUTHORS   Bradbury,L.E., Kansas,G.S., Levy,S., Evans,R.L. and Tedder,T.F.
  TITLE     The CD19/CD21 signal transducing complex of human B lymphocytes
            includes the target of antiproliferative antibody-1 and Leu-13
            molecules
  JOURNAL   J. Immunol. 149 (9), 2841-2850 (1992)
   PUBMED   1383329
REFERENCE   7  (bases 1 to 1497)
  AUTHORS   Levy,S., Nguyen,V.Q., Andria,M.L. and Takahashi,S.
  TITLE     Structure and membrane topology of TAPA-1
  JOURNAL   J. Biol. Chem. 266 (22), 14597-14602 (1991)
   PUBMED   1860863
REFERENCE   8  (bases 1 to 1497)
  AUTHORS   Andria,M.L., Hsieh,C.L., Oren,R., Francke,U. and Levy,S.
  TITLE     Genomic organization and chromosomal localization of the TAPA-1
            gene
  JOURNAL   J. Immunol. 147 (3), 1030-1036 (1991)
   PUBMED   1650385
REFERENCE   9  (bases 1 to 1497)
  AUTHORS   Takahashi,S., Doss,C., Levy,S. and Levy,R.
  TITLE     TAPA-1, the target of an antiproliferative antibody, is associated
            on the cell surface with the Leu-13 antigen
  JOURNAL   J. Immunol. 145 (7), 2207-2213 (1990)
   PUBMED   2398277
REFERENCE   10 (bases 1 to 1497)
  AUTHORS   Oren,R., Takahashi,S., Doss,C., Levy,R. and Levy,S.
  TITLE     TAPA-1, the target of an antiproliferative antibody, defines a new
            family of transmembrane proteins
  JOURNAL   Mol. Cell. Biol. 10 (8), 4007-4015 (1990)
   PUBMED   1695320
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BG397506.1, BQ709484.1,
            M33680.1, BC002978.1 and CB055265.1.
            This sequence is a reference standard in the RefSeqGene project.
            On Apr 6, 2005 this sequence version replaced gi:21237760.
            
            Summary: The protein encoded by this gene is a member of the
            transmembrane 4 superfamily, also known as the tetraspanin family.
            Most of these members are cell-surface proteins that are
            characterized by the presence of four hydrophobic domains. The
            proteins mediate signal transduction events that play a role in the
            regulation of cell development, activation, growth and motility.
            This encoded protein is a cell surface glycoprotein that is known
            to complex with integrins. This protein appears to promote muscle
            cell fusion and support myotube maintenance. Also it may be
            involved in signal transduction. This gene is localized in the
            tumor-suppressor gene region and thus it is a candidate gene for
            malignancies. [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC093047.1, M33680.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-18                BG397506.1         4-21
            19-104              BQ709484.1         16-101
            105-193             M33680.1           110-198
            194-1475            BC002978.1         1-1282
            1476-1497           CB055265.1         328-349
FEATURES             Location/Qualifiers
     source          1..1497
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="11"
                     /map="11p15.5"
     gene            1..1497
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /note="CD81 molecule"
                     /db_xref="GeneID:975"
                     /db_xref="HGNC:1701"
                     /db_xref="HPRD:08924"
                     /db_xref="MIM:186845"
     exon            1..299
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /inference="alignment:Splign:1.39.8"
     variation       19
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183863782"
     variation       64
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11546014"
     variation       231
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376883566"
     CDS             234..944
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /note="CD81 antigen (target of antiproliferative antibody
                     1); 26 kDa cell surface protein TAPA-1; tspan-28;
                     tetraspanin-28"
                     /codon_start=1
                     /product="CD81 antigen"
                     /protein_id="NP_004347.1"
                     /db_xref="GI:4757944"
                     /db_xref="CCDS:CCDS7734.1"
                     /db_xref="GeneID:975"
                     /db_xref="HGNC:1701"
                     /db_xref="HPRD:08924"
                     /db_xref="MIM:186845"
                     /translation="
MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY
"
     misc_feature    258..923
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /note="Tetraspanin family; Region: Tetraspannin;
                     pfam00335"
                     /db_xref="CDD:201163"
     misc_feature    270..332
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P60033.1);
                     transmembrane region"
     misc_feature    423..485
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P60033.1);
                     transmembrane region"
     misc_feature    501..569
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P60033.1);
                     transmembrane region"
     misc_feature    570..839
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /note="Tetraspanin, extracellular domain or large
                     extracellular loop (LEL), CD81_like subfamily.
                     Tetraspanins are trans-membrane proteins with 4
                     trans-membrane segments. Both the N- and C-termini lie on
                     the intracellular side of the membrane. This alignment...;
                     Region: CD81_like_LEL; cd03151"
                     /db_xref="CDD:48415"
     misc_feature    order(573..575,588..590,600..602,606..611,618..620,
                     666..668,678..683,690..695)
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:48415"
     misc_feature    837..905
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P60033.1);
                     transmembrane region"
     STS             268..307
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /standard_name="Cd81"
                     /db_xref="UniSTS:141296"
     exon            300..414
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /inference="alignment:Splign:1.39.8"
     variation       311
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:34400531"
     variation       340
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374100694"
     variation       359
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370819047"
     variation       392
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200365372"
     variation       394
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368611423"
     exon            415..512
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /inference="alignment:Splign:1.39.8"
     variation       467
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11546013"
     variation       473
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61731556"
     variation       506
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372129042"
     exon            513..587
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /inference="alignment:Splign:1.39.8"
     variation       521
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202086417"
     variation       557
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138086545"
     exon            588..692
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /inference="alignment:Splign:1.39.8"
     variation       617
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376534440"
     variation       636
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181171080"
     variation       647
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143644902"
     variation       659
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369472934"
     variation       686
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146021958"
     exon            693..794
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /inference="alignment:Splign:1.39.8"
     variation       750
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138631483"
     variation       751
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149336067"
     exon            795..881
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /inference="alignment:Splign:1.39.8"
     variation       816
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144435973"
     variation       817
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184960624"
     variation       821
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:148404749"
     variation       830
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:14077"
     variation       848
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375953854"
     variation       863
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145975232"
     variation       864
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139884987"
     variation       869..870
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:35457972"
     variation       869
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144381255"
     variation       870
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373342342"
     variation       872
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2229751"
     exon            882..1497
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /inference="alignment:Splign:1.39.8"
     variation       887
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139978456"
     variation       893
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371516232"
     variation       950
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188175983"
     variation       951
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368448552"
     variation       984
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:10645"
     STS             986..1134
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /standard_name="WI-18911"
                     /db_xref="UniSTS:60814"
     variation       1021
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35800690"
     variation       1035
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74701050"
     variation       1041
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1063316"
     variation       1060
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1804493"
     variation       1108
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113585763"
     variation       1144
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:143793173"
     variation       1185
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1049390"
     variation       1197..1198
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:34939011"
     variation       1278
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1049549"
     STS             1324..1415
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /standard_name="SHGC-57855"
                     /db_xref="UniSTS:69665"
     STS             1328..1447
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /standard_name="GDB:678191"
                     /db_xref="UniSTS:9560"
     variation       1400
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1049648"
     variation       1403..1404
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace=""
                     /replace="ac"
                     /db_xref="dbSNP:138604169"
     variation       1406
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1049652"
     variation       1407
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183619205"
     variation       1410
                     /gene="CD81"
                     /gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1049659"
ORIGIN      
gagcgagcgcgcaacggcggcgacggcggcgaccccaccgcgcatcctgccaggcctccggcgcccagcgccccacgcgcccccgcgcccccgcgcccccgcgcccctttcttcgcgcccccgcccctcggcccgccaggcccccttgccggccacccgccaggccccgcgccggcccgcccgccgcccaggaccggcccgcgccccgcaggccgcccgccgcccgcgccgccatgggagtggagggctgcaccaagtgcatcaagtacctgctcttcgtcttcaatttcgtcttctggctggctggaggcgtgatcctgggtgtggccctgtggctccgccatgacccgcagaccaccaacctcctgtatctggagctgggagacaagcccgcgcccaacaccttctatgtaggcatctacatcctcatcgctgtgggcgctgtcatgatgttcgttggcttcctgggctgctacggggccatccaggaatcccagtgcctgctggggacgttcttcacctgcctggtcatcctgtttgcctgtgaggtggccgccggcatctggggctttgtcaacaaggaccagatcgccaaggatgtgaagcagttctatgaccaggccctacagcaggccgtggtggatgatgacgccaacaacgccaaggctgtggtgaagaccttccacgagacgcttgactgctgtggctccagcacactgactgctttgaccacctcagtgctcaagaacaatttgtgtccctcgggcagcaacatcatcagcaacctcttcaaggaggactgccaccagaagatcgatgacctcttctccgggaagctgtacctcatcggcattgctgccatcgtggtcgctgtgatcatgatcttcgagatgatcctgagcatggtgctgtgctgtggcatccggaacagctccgtgtactgaggccccgcagctctggccacagggacctctgcagtgccccctaagtgacccggacacttccgagggggccatcaccgcctgtgtatataacgtttccggtattactctgctacacgtagcctttttacttttggggttttgtttttgttctgaactttcctgttaccttttcagggctgacgtcacatgtaggtggcgtgtatgagtggagacgggcctgggtcttggggactggagggcaggggtccttctgccctggggtcccagggtgctctgcctgctcagccaggcctctcctgggagccactcgcccagagactcagcttggccaacttggggggctgtgtccacccagcccgcccgtcctgtgggctgcacagctcaccttgttccctcctgccccggttcgagagccgagtctgtgggcactctctgccttcatgcacctgtcctttctaacacgtcgccttcaactgtaatcacaacatcctgactccgtcatttaataaagaaggaacatcaggcatgctaccaggcctgtgcagtccctcag
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:975 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:975 -> Biological process: GO:0000187 [activation of MAPK activity] evidence: IDA
            GeneID:975 -> Biological process: GO:0006661 [phosphatidylinositol biosynthetic process] evidence: IDA
            GeneID:975 -> Biological process: GO:0008104 [protein localization] evidence: IDA
            GeneID:975 -> Biological process: GO:0008283 [cell proliferation] evidence: TAS
            GeneID:975 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: IDA
            GeneID:975 -> Biological process: GO:0043128 [positive regulation of 1-phosphatidylinositol 4-kinase activity] evidence: IDA
            GeneID:975 -> Biological process: GO:0046488 [phosphatidylinositol metabolic process] evidence: IDA
            GeneID:975 -> Biological process: GO:0046718 [viral entry into host cell] evidence: TAS
            GeneID:975 -> Biological process: GO:0046813 [virion attachment, binding of host cell surface receptor] evidence: TAS
            GeneID:975 -> Biological process: GO:0050731 [positive regulation of peptidyl-tyrosine phosphorylation] evidence: IDA
            GeneID:975 -> Biological process: GO:0050776 [regulation of immune response] evidence: TAS
            GeneID:975 -> Cellular component: GO:0001772 [immunological synapse] evidence: IDA
            GeneID:975 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
            GeneID:975 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.