2024-04-27 11:48:59, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004343 1929 bp mRNA linear PRI 01-JUL-2013 DEFINITION Homo sapiens calreticulin (CALR), mRNA. ACCESSION NM_004343 VERSION NM_004343.3 GI:209862753 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1929) AUTHORS Kabbage,M., Trimeche,M., Bergaoui,S., Hammann,P., Kuhn,L., Hamrita,B., ben Nasr,H., Chaieb,A., Chouchane,L. and Chahed,K. TITLE Calreticulin expression in infiltrating ductal breast carcinomas: relationships with disease progression and humoral immune responses JOURNAL Tumour Biol. 34 (2), 1177-1188 (2013) PUBMED 23334957 REMARK GeneRIF: Upregulation of calreticulin is associated with infiltrating ductal breast carcinomas. REFERENCE 2 (bases 1 to 1929) AUTHORS Ling,S., Cline,E.N., Haug,T.S., Fox,D.A. and Holoshitz,J. TITLE Citrullinated calreticulin potentiates rheumatoid arthritis shared epitope signaling JOURNAL Arthritis Rheum. 65 (3), 618-626 (2013) PUBMED 23233327 REMARK GeneRIF: Citrullinated CRT is overabundant in the rheumatoid arthritis synovium and potentiates shared epitope-activated signaling in vitro. REFERENCE 3 (bases 1 to 1929) AUTHORS Yang,M.S., Wang,H.S., Wang,B.S., Li,W.H., Pang,Z.F., Zou,B.K., Zhang,X., Shi,X.T., Mu,D.B., Zhang,D.X., Gao,Y.S., Sun,X.W. and Xia,S.J. TITLE A comparative proteomic study identified calreticulin and prohibitin up-regulated in adrenocortical carcinomas JOURNAL Diagn Pathol 8, 58 (2013) PUBMED 23587357 REMARK GeneRIF: Calreticulin and prohibitin were identified to be novel candidate biomarkers for adrenocortical carcinomas. Publication Status: Online-Only REFERENCE 4 (bases 1 to 1929) AUTHORS van der Harst,P., Zhang,W., Mateo Leach,I., Rendon,A., Verweij,N., Sehmi,J., Paul,D.S., Elling,U., Allayee,H., Li,X., Radhakrishnan,A., Tan,S.T., Voss,K., Weichenberger,C.X., Albers,C.A., Al-Hussani,A., Asselbergs,F.W., Ciullo,M., Danjou,F., Dina,C., Esko,T., Evans,D.M., Franke,L., Gogele,M., Hartiala,J., Hersch,M., Holm,H., Hottenga,J.J., Kanoni,S., Kleber,M.E., Lagou,V., Langenberg,C., Lopez,L.M., Lyytikainen,L.P., Melander,O., Murgia,F., Nolte,I.M., O'Reilly,P.F., Padmanabhan,S., Parsa,A., Pirastu,N., Porcu,E., Portas,L., Prokopenko,I., Ried,J.S., Shin,S.Y., Tang,C.S., Teumer,A., Traglia,M., Ulivi,S., Westra,H.J., Yang,J., Zhao,J.H., Anni,F., Abdellaoui,A., Attwood,A., Balkau,B., Bandinelli,S., Bastardot,F., Benyamin,B., Boehm,B.O., Cookson,W.O., Das,D., de Bakker,P.I., de Boer,R.A., de Geus,E.J., de Moor,M.H., Dimitriou,M., Domingues,F.S., Doring,A., Engstrom,G., Eyjolfsson,G.I., Ferrucci,L., Fischer,K., Galanello,R., Garner,S.F., Genser,B., Gibson,Q.D., Girotto,G., Gudbjartsson,D.F., Harris,S.E., Hartikainen,A.L., Hastie,C.E., Hedblad,B., Illig,T., Jolley,J., Kahonen,M., Kema,I.P., Kemp,J.P., Liang,L., Lloyd-Jones,H., Loos,R.J., Meacham,S., Medland,S.E., Meisinger,C., Memari,Y., Mihailov,E., Miller,K., Moffatt,M.F., Nauck,M., Novatchkova,M., Nutile,T., Olafsson,I., Onundarson,P.T., Parracciani,D., Penninx,B.W., Perseu,L., Piga,A., Pistis,G., Pouta,A., Puc,U., Raitakari,O., Ring,S.M., Robino,A., Ruggiero,D., Ruokonen,A., Saint-Pierre,A., Sala,C., Salumets,A., Sambrook,J., Schepers,H., Schmidt,C.O., Sillje,H.H., Sladek,R., Smit,J.H., Starr,J.M., Stephens,J., Sulem,P., Tanaka,T., Thorsteinsdottir,U., Tragante,V., van Gilst,W.H., van Pelt,L.J., van Veldhuisen,D.J., Volker,U., Whitfield,J.B., Willemsen,G., Winkelmann,B.R., Wirnsberger,G., Algra,A., Cucca,F., d'Adamo,A.P., Danesh,J., Deary,I.J., Dominiczak,A.F., Elliott,P., Fortina,P., Froguel,P., Gasparini,P., Greinacher,A., Hazen,S.L., Jarvelin,M.R., Khaw,K.T., Lehtimaki,T., Maerz,W., Martin,N.G., Metspalu,A., Mitchell,B.D., Montgomery,G.W., Moore,C., Navis,G., Pirastu,M., Pramstaller,P.P., Ramirez-Solis,R., Schadt,E., Scott,J., Shuldiner,A.R., Smith,G.D., Smith,J.G., Snieder,H., Sorice,R., Spector,T.D., Stefansson,K., Stumvoll,M., Tang,W.H., Toniolo,D., Tonjes,A., Visscher,P.M., Vollenweider,P., Wareham,N.J., Wolffenbuttel,B.H., Boomsma,D.I., Beckmann,J.S., Dedoussis,G.V., Deloukas,P., Ferreira,M.A., Sanna,S., Uda,M., Hicks,A.A., Penninger,J.M., Gieger,C., Kooner,J.S., Ouwehand,W.H., Soranzo,N. and Chambers,J.C. TITLE Seventy-five genetic loci influencing the human red blood cell JOURNAL Nature 492 (7429), 369-375 (2012) PUBMED 23222517 REFERENCE 5 (bases 1 to 1929) AUTHORS Mans,S., Banz,Y., Mueller,B.U. and Pabst,T. TITLE The angiogenesis inhibitor vasostatin is regulated by neutrophil elastase-dependent cleavage of calreticulin in AML patients JOURNAL Blood 120 (13), 2690-2699 (2012) PUBMED 22915645 REMARK GeneRIF: High calreticulin is associated with acute myeloid leukemia. REFERENCE 6 (bases 1 to 1929) AUTHORS Hochstrasser,D.F., Frutiger,S., Paquet,N., Bairoch,A., Ravier,F., Pasquali,C., Sanchez,J.C., Tissot,J.D., Bjellqvist,B., Vargas,R. et al. TITLE Human liver protein map: a reference database established by microsequencing and gel comparison JOURNAL Electrophoresis 13 (12), 992-1001 (1992) PUBMED 1286669 REFERENCE 7 (bases 1 to 1929) AUTHORS Rasmussen,H.H., van Damme,J., Puype,M., Gesser,B., Celis,J.E. and Vandekerckhove,J. TITLE Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes JOURNAL Electrophoresis 13 (12), 960-969 (1992) PUBMED 1286667 REFERENCE 8 (bases 1 to 1929) AUTHORS McCauliffe,D.P., Yang,Y.S., Wilson,J., Sontheimer,R.D. and Capra,J.D. TITLE The 5'-flanking region of the human calreticulin gene shares homology with the human GRP78, GRP94, and protein disulfide isomerase promoters JOURNAL J. Biol. Chem. 267 (4), 2557-2562 (1992) PUBMED 1733953 REFERENCE 9 (bases 1 to 1929) AUTHORS Rokeach,L.A., Haselby,J.A., Meilof,J.F., Smeenk,R.J., Unnasch,T.R., Greene,B.M. and Hoch,S.O. TITLE Characterization of the autoantigen calreticulin JOURNAL J. Immunol. 147 (9), 3031-3039 (1991) PUBMED 1919005 REFERENCE 10 (bases 1 to 1929) AUTHORS Rojiani,M.V., Finlay,B.B., Gray,V. and Dedhar,S. TITLE In vitro interaction of a polypeptide homologous to human Ro/SS-A antigen (calreticulin) with a highly conserved amino acid sequence in the cytoplasmic domain of integrin alpha subunits JOURNAL Biochemistry 30 (41), 9859-9866 (1991) PUBMED 1911778 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC092069.2 and BC007911.1. This sequence is a reference standard in the RefSeqGene project. On Oct 21, 2008 this sequence version replaced gi:5921996. Summary: Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum. It is also found in the nucleus, suggesting that it may have a role in transcription regulation. Calreticulin binds to the synthetic peptide KLGFFKR, which is almost identical to an amino acid sequence in the DNA-binding domain of the superfamily of nuclear receptors. Calreticulin binds to antibodies in certain sera of systemic lupus and Sjogren patients which contain anti-Ro/SSA antibodies, it is highly conserved among species, and it is located in the endoplasmic and sarcoplasmic reticulum where it may bind calcium. The amino terminus of calreticulin interacts with the DNA-binding domain of the glucocorticoid receptor and prevents the receptor from binding to its specific glucocorticoid response element. Calreticulin can inhibit the binding of androgen receptor to its hormone-responsive DNA element and can inhibit androgen receptor and retinoic acid receptor transcriptional activities in vivo, as well as retinoic acid-induced neuronal differentiation. Thus, calreticulin can act as an important modulator of the regulation of gene transcription by nuclear hormone receptors. Systemic lupus erythematosus is associated with increased autoantibody titers against calreticulin but calreticulin is not a Ro/SS-A antigen. Earlier papers referred to calreticulin as an Ro/SS-A antigen but this was later disproven. Increased autoantibody titer against human calreticulin is found in infants with complete congenital heart block of both the IgG and IgM classes. [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC007911.1, M84739.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-171 AC092069.2 50907-51077 c 172-273 AC092069.2 50442-50543 c 274-477 AC092069.2 50046-50249 c 478-572 AC092069.2 49530-49624 c 573-782 AC092069.2 49225-49434 c 783-896 AC092069.2 49023-49136 c 897-1040 AC092069.2 48790-48933 c 1041-1133 AC092069.2 46048-46140 c 1134-1881 AC092069.2 45217-45964 c 1882-1929 BC007911.1 1873-1920 FEATURES Location/Qualifiers source 1..1929 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="19" /map="19p13.3-p13.2" gene 1..1929 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /note="calreticulin" /db_xref="GeneID:811" /db_xref="HGNC:1455" /db_xref="HPRD:00169" /db_xref="MIM:109091" exon 1..171 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /inference="alignment:Splign:1.39.8" variation 2 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:28365950" variation 21 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:41300080" variation 33 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:374628652" misc_feature 45..47 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /note="upstream in-frame stop codon" variation 60 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:11547567" variation 72 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="g" /db_xref="dbSNP:370935055" variation 77 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:190251647" CDS 81..1334 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /note="Sicca syndrome antigen A (autoantigen Ro; calreticulin); CRP55; ERp60; HACBP; grp60; calregulin; endoplasmic reticulum resident protein 60" /codon_start=1 /product="calreticulin precursor" /protein_id="NP_004334.1" /db_xref="GI:4757900" /db_xref="CCDS:CCDS12288.1" /db_xref="GeneID:811" /db_xref="HGNC:1455" /db_xref="HPRD:00169" /db_xref="MIM:109091" /translation="
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
" sig_peptide 81..131 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /inference="COORDINATES: ab initio prediction:SignalP:4.0" mat_peptide 132..1331 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /product="calreticulin" misc_feature 132..671 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P27797.1); Region: N-domain" misc_feature 144..1076 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /note="Calreticulin family; Region: Calreticulin; pfam00262" /db_xref="CDD:189477" misc_feature 222..224 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /experiment="experimental evidence, no additional details recorded" /note="N6-acetyllysine; propagated from UniProtKB/Swiss-Prot (P27797.1); acetylation site" misc_feature 555..557 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /experiment="experimental evidence, no additional details recorded" /note="N6-acetyllysine; propagated from UniProtKB/Swiss-Prot (P27797.1); acetylation site" misc_feature 651..845 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P27797.1); Region: 4 X approximate repeats" misc_feature 672..1004 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P27797.1); Region: P-domain" misc_feature 705..707 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /experiment="experimental evidence, no additional details recorded" /note="N6-acetyllysine; propagated from UniProtKB/Swiss-Prot (P27797.1); acetylation site" misc_feature 855..971 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P27797.1); Region: 3 X approximate repeats" misc_feature 1005..1331 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P27797.1); Region: C-domain" misc_feature 1320..1331 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P27797.1); Region: Prevents secretion from ER" variation 99 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:201581541" variation 113 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:368501056" variation 130 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="g" /db_xref="dbSNP:147368353" exon 172..273 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /inference="alignment:Splign:1.39.8" variation 172 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:146793150" variation 174 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:377744854" variation 175 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="g" /db_xref="dbSNP:140472880" variation 185 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:145899020" variation 250 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:138503495" variation 251 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:200631709" variation 257 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:76337616" exon 274..477 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /inference="alignment:Splign:1.39.8" variation 297 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:370585408" variation 323 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="g" /db_xref="dbSNP:11547568" variation 349 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:373993748" variation 350 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="g" /db_xref="dbSNP:199928255" variation 357 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="g" /db_xref="dbSNP:370869315" variation 404 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:375093236" variation 407 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:201824031" variation 416 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:202106445" variation 432 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:201017921" variation 461 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="t" /db_xref="dbSNP:375318260" variation 463 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:200421584" variation 466 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="t" /db_xref="dbSNP:200105930" exon 478..572 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /inference="alignment:Splign:1.39.8" variation 482 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:371325705" variation 510 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:149216548" variation 531 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="c" /db_xref="dbSNP:192388573" variation 542 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:143361476" exon 573..782 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /inference="alignment:Splign:1.39.8" variation 574 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:148345745" variation 587 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="t" /db_xref="dbSNP:187996595" variation 596 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:141216842" variation 602 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="g" /replace="t" /db_xref="dbSNP:201344231" variation 606 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:11547569" variation 646 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="g" /db_xref="dbSNP:147369833" variation 659 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:146732841" variation 674 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:143370494" variation 675 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:199565419" variation 686 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:79497711" variation 717 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:369547041" variation 727 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:200173883" variation 728 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:200486676" variation 745 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:371806484" variation 755 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:139658454" variation 762 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:149740908" exon 783..896 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /inference="alignment:Splign:1.39.8" variation 818 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:370254574" variation 830 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="g" /db_xref="dbSNP:144562269" variation 851 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:371463754" variation 861 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="g" /replace="t" /db_xref="dbSNP:11547563" variation 867 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="g" /db_xref="dbSNP:148447453" variation 878 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="g" /replace="t" /db_xref="dbSNP:372688428" exon 897..1040 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /inference="alignment:Splign:1.39.8" variation 897 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="g" /db_xref="dbSNP:367922867" variation 938 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="g" /db_xref="dbSNP:11547562" variation 983 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:371988722" variation 984 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:375135016" variation 1016 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="g" /db_xref="dbSNP:111306057" variation 1028 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:370016483" variation 1032 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="g" /db_xref="dbSNP:372777769" exon 1041..1133 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /inference="alignment:Splign:1.39.8" variation 1074 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:368136620" variation 1082 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:146803878" variation 1091 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:140610430" variation 1125 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:144233437" exon 1134..1911 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /inference="alignment:Splign:1.39.8" variation 1166 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:151032910" variation 1219 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:201971744" variation 1222 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="c" /db_xref="dbSNP:143880510" variation 1232 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="c" /db_xref="dbSNP:370029737" variation 1259 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:374121178" variation 1272 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:150264068" variation 1298 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:186827895" variation 1301 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:11547565" variation 1325 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:148604761" STS 1345..1589 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /standard_name="STS-M84739" /db_xref="UniSTS:36938" variation 1367 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:201689726" variation 1370 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:376336055" variation 1371 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:200311949" variation 1379 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:370833569" variation 1388 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="g" /replace="t" /db_xref="dbSNP:1049481" variation 1454 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="g" /replace="t" /db_xref="dbSNP:1063382" variation 1508 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:1063386" variation 1509 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:1063387" variation 1510 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:16978824" variation 1511..1512 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="" /replace="tt" /db_xref="dbSNP:71813450" variation 1511 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:1063388" variation 1511 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="" /replace="t" /db_xref="dbSNP:371347484" variation 1528 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="" /replace="t" /replace="tt" /db_xref="dbSNP:58546164" variation 1621 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="c" /db_xref="dbSNP:1063415" variation 1630 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="g" /replace="t" /db_xref="dbSNP:1803237" variation 1631 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="g" /db_xref="dbSNP:191183059" variation 1728 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="g" /replace="t" /db_xref="dbSNP:11210" variation 1744 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:9978" variation 1783..1784 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="" /replace="c" /db_xref="dbSNP:35275976" variation 1784 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="c" /db_xref="dbSNP:1803236" variation 1795 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:1050279" variation 1796..1797 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="" /replace="c" /db_xref="dbSNP:35885654" variation 1823 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="t" /db_xref="dbSNP:1050434" variation 1833 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="c" /replace="g" /db_xref="dbSNP:1801594" variation 1847 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="t" /db_xref="dbSNP:15340" polyA_signal 1894..1899 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" polyA_site 1911 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" variation 1911 /gene="CALR" /gene_synonym="cC1qR; CRT; RO; SSA" /replace="a" /replace="c" /db_xref="dbSNP:3177935" ORIGIN
gcggcgtccgtccgtactgcagagccgctgccggagggtcgttttaaagggcccgcgcgttgccgccccctcggcccgccatgctgctatccgtgccgctgctgctcggcctcctcggcctggccgtcgccgagcctgccgtctacttcaaggagcagtttctggacggagacgggtggacttcccgctggatcgaatccaaacacaagtcagattttggcaaattcgttctcagttccggcaagttctacggtgacgaggagaaagataaaggtttgcagacaagccaggatgcacgcttttatgctctgtcggccagtttcgagcctttcagcaacaaaggccagacgctggtggtgcagttcacggtgaaacatgagcagaacatcgactgtgggggcggctatgtgaagctgtttcctaatagtttggaccagacagacatgcacggagactcagaatacaacatcatgtttggtcccgacatctgtggccctggcaccaagaaggttcatgtcatcttcaactacaagggcaagaacgtgctgatcaacaaggacatccgttgcaaggatgatgagtttacacacctgtacacactgattgtgcggccagacaacacctatgaggtgaagattgacaacagccaggtggagtccggctccttggaagacgattgggacttcctgccacccaagaagataaaggatcctgatgcttcaaaaccggaagactgggatgagcgggccaagatcgatgatcccacagactccaagcctgaggactgggacaagcccgagcatatccctgaccctgatgctaagaagcccgaggactgggatgaagagatggacggagagtgggaacccccagtgattcagaaccctgagtacaagggtgagtggaagccccggcagatcgacaacccagattacaagggcacttggatccacccagaaattgacaaccccgagtattctcccgatcccagtatctatgcctatgataactttggcgtgctgggcctggacctctggcaggtcaagtctggcaccatctttgacaacttcctcatcaccaacgatgaggcatacgctgaggagtttggcaacgagacgtggggcgtaacaaaggcagcagagaaacaaatgaaggacaaacaggacgaggagcagaggcttaaggaggaggaagaagacaagaaacgcaaagaggaggaggaggcagaggacaaggaggatgatgaggacaaagatgaggatgaggaggatgaggaggacaaggaggaagatgaggaggaagatgtccccggccaggccaaggacgagctgtagagaggcctgcctccagggctggactgaggcctgagcgctcctgccgcagagctggccgcgccaaataatgtctctgtgagactcgagaactttcatttttttccaggctggttcggatttggggtggattttggttttgttcccctcctccactctcccccaccccctccccgcccttttttttttttttttttaaactggtattttatctttgattctccttcagccctcacccctggttctcatctttcttgatcaacatcttttcttgcctctgtccccttctctcatctcttagctcccctccaacctggggggcagtggtgtggagaagccacaggcctgagatttcatctgctctccttcctggagcccagaggagggcagcagaagggggtggtgtctccaaccccccagcactgaggaagaacggggctcttctcatttcacccctccctttctcccctgcccccaggactgggccacttctgggtggggcagtgggtcccagattggctcacactgagaatgtaagaactacaaacaaaatttctattaaattaaattttgtgtctccaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:811 -> Molecular function: GO:0001849 [complement component C1q binding] evidence: TAS GeneID:811 -> Molecular function: GO:0003677 [DNA binding] evidence: NAS GeneID:811 -> Molecular function: GO:0003729 [mRNA binding] evidence: IDA GeneID:811 -> Molecular function: GO:0005178 [integrin binding] evidence: IPI GeneID:811 -> Molecular function: GO:0005506 [iron ion binding] evidence: IEA GeneID:811 -> Molecular function: GO:0005509 [calcium ion binding] evidence: ISS GeneID:811 -> Molecular function: GO:0005509 [calcium ion binding] evidence: TAS GeneID:811 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:811 -> Molecular function: GO:0008270 [zinc ion binding] evidence: TAS GeneID:811 -> Molecular function: GO:0030246 [carbohydrate binding] evidence: TAS GeneID:811 -> Molecular function: GO:0031625 [ubiquitin protein ligase binding] evidence: IPI GeneID:811 -> Molecular function: GO:0042277 [peptide binding] evidence: IEA GeneID:811 -> Molecular function: GO:0042562 [hormone binding] evidence: IEA GeneID:811 -> Molecular function: GO:0044183 [protein binding involved in protein folding] evidence: TAS GeneID:811 -> Molecular function: GO:0050681 [androgen receptor binding] evidence: IDA GeneID:811 -> Molecular function: GO:0051082 [unfolded protein binding] evidence: TAS GeneID:811 -> Molecular function: GO:0051087 [chaperone binding] evidence: TAS GeneID:811 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: IDA GeneID:811 -> Biological process: GO:0002474 [antigen processing and presentation of peptide antigen via MHC class I] evidence: TAS GeneID:811 -> Biological process: GO:0002479 [antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent] evidence: TAS GeneID:811 -> Biological process: GO:0002502 [peptide antigen assembly with MHC class I protein complex] evidence: ISS GeneID:811 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: TAS GeneID:811 -> Biological process: GO:0006457 [protein folding] evidence: TAS GeneID:811 -> Biological process: GO:0006611 [protein export from nucleus] evidence: IDA GeneID:811 -> Biological process: GO:0006874 [cellular calcium ion homeostasis] evidence: TAS GeneID:811 -> Biological process: GO:0006987 [activation of signaling protein activity involved in unfolded protein response] evidence: TAS GeneID:811 -> Biological process: GO:0007050 [cell cycle arrest] evidence: IGI GeneID:811 -> Biological process: GO:0007283 [spermatogenesis] evidence: IEA GeneID:811 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: IGI GeneID:811 -> Biological process: GO:0010628 [positive regulation of gene expression] evidence: IEA GeneID:811 -> Biological process: GO:0017148 [negative regulation of translation] evidence: ISS GeneID:811 -> Biological process: GO:0017148 [negative regulation of translation] evidence: TAS GeneID:811 -> Biological process: GO:0018279 [protein N-linked glycosylation via asparagine] evidence: TAS GeneID:811 -> Biological process: GO:0022417 [protein maturation by protein folding] evidence: TAS GeneID:811 -> Biological process: GO:0030866 [cortical actin cytoskeleton organization] evidence: IEA GeneID:811 -> Biological process: GO:0030968 [endoplasmic reticulum unfolded protein response] evidence: TAS GeneID:811 -> Biological process: GO:0032355 [response to estradiol stimulus] evidence: IEA GeneID:811 -> Biological process: GO:0033144 [negative regulation of intracellular steroid hormone receptor signaling pathway] evidence: IDA GeneID:811 -> Biological process: GO:0033574 [response to testosterone stimulus] evidence: IEA GeneID:811 -> Biological process: GO:0034504 [protein localization to nucleus] evidence: IDA GeneID:811 -> Biological process: GO:0040020 [regulation of meiosis] evidence: IEA GeneID:811 -> Biological process: GO:0042493 [response to drug] evidence: IEA GeneID:811 -> Biological process: GO:0042590 [antigen processing and presentation of exogenous peptide antigen via MHC class I] evidence: TAS GeneID:811 -> Biological process: GO:0042921 [glucocorticoid receptor signaling pathway] evidence: TAS GeneID:811 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS GeneID:811 -> Biological process: GO:0043687 [post-translational protein modification] evidence: TAS GeneID:811 -> Biological process: GO:0044267 [cellular protein metabolic process] evidence: TAS GeneID:811 -> Biological process: GO:0045665 [negative regulation of neuron differentiation] evidence: IDA GeneID:811 -> Biological process: GO:0045740 [positive regulation of DNA replication] evidence: IGI GeneID:811 -> Biological process: GO:0045787 [positive regulation of cell cycle] evidence: IGI GeneID:811 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: IDA GeneID:811 -> Biological process: GO:0048387 [negative regulation of retinoic acid receptor signaling pathway] evidence: IDA GeneID:811 -> Biological process: GO:0050766 [positive regulation of phagocytosis] evidence: ISS GeneID:811 -> Biological process: GO:0050821 [protein stabilization] evidence: ISS GeneID:811 -> Biological process: GO:0050821 [protein stabilization] evidence: TAS GeneID:811 -> Biological process: GO:0051208 [sequestering of calcium ion] evidence: TAS GeneID:811 -> Biological process: GO:0055007 [cardiac muscle cell differentiation] evidence: IEA GeneID:811 -> Biological process: GO:0071285 [cellular response to lithium ion] evidence: IEA GeneID:811 -> Biological process: GO:0090398 [cellular senescence] evidence: IGI GeneID:811 -> Biological process: GO:1900026 [positive regulation of substrate adhesion-dependent cell spreading] evidence: IMP GeneID:811 -> Biological process: GO:2000510 [positive regulation of dendritic cell chemotaxis] evidence: IMP GeneID:811 -> Cellular component: GO:0001669 [acrosomal vesicle] evidence: IEA GeneID:811 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS GeneID:811 -> Cellular component: GO:0005578 [proteinaceous extracellular matrix] evidence: IEA GeneID:811 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA GeneID:811 -> Cellular component: GO:0005622 [intracellular] evidence: TAS GeneID:811 -> Cellular component: GO:0005634 [nucleus] evidence: IDA GeneID:811 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA GeneID:811 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: TAS GeneID:811 -> Cellular component: GO:0005788 [endoplasmic reticulum lumen] evidence: IDA GeneID:811 -> Cellular component: GO:0005788 [endoplasmic reticulum lumen] evidence: TAS GeneID:811 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: IEA GeneID:811 -> Cellular component: GO:0005829 [cytosol] evidence: IDA GeneID:811 -> Cellular component: GO:0005844 [polysome] evidence: ISS GeneID:811 -> Cellular component: GO:0009897 [external side of plasma membrane] evidence: IEA GeneID:811 -> Cellular component: GO:0009986 [cell surface] evidence: TAS GeneID:811 -> Cellular component: GO:0033018 [sarcoplasmic reticulum lumen] evidence: IEA GeneID:811 -> Cellular component: GO:0042824 [MHC class I peptide loading complex] evidence: ISS GeneID:811 -> Cellular component: GO:0048471 [perinuclear region of cytoplasm] evidence: IDA GeneID:811 -> Cellular component: GO:0071556 [integral to lumenal side of endoplasmic reticulum membrane] evidence: TAS GeneID:811 -> Cellular component: GO:0071682 [endocytic vesicle lumen] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.