LOCUS       NM_004098               2908 bp    mRNA    linear   PRI 29-JUN-2013
DEFINITION  Homo sapiens empty spiracles homeobox 2 (EMX2), transcript variant
            1, mRNA.
ACCESSION   NM_004098
VERSION     NM_004098.3  GI:164607120
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2908)
  AUTHORS   Li,X., Hawkins,G.A., Ampleford,E.J., Moore,W.C., Li,H.,
            Hastie,A.T., Howard,T.D., Boushey,H.A., Busse,W.W., Calhoun,W.J.,
            Castro,M., Erzurum,S.C., Israel,E., Lemanske,R.F. Jr.,
            Szefler,S.J., Wasserman,S.I., Wenzel,S.E., Peters,S.P., Meyers,D.A.
            and Bleecker,E.R.
  TITLE     Genome-wide association study identifies T1 pathway genes
            associated with lung function in asthmatic patients
  JOURNAL   J. Allergy Clin. Immunol. (2013) In press
   PUBMED   23541324
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 2908)
  AUTHORS   Wilk,J.B., Shrine,N.R., Loehr,L.R., Zhao,J.H., Manichaikul,A.,
            Lopez,L.M., Smith,A.V., Heckbert,S.R., Smolonska,J., Tang,W.,
            Loth,D.W., Curjuric,I., Hui,J., Cho,M.H., Latourelle,J.C.,
            Henry,A.P., Aldrich,M., Bakke,P., Beaty,T.H., Bentley,A.R.,
            Borecki,I.B., Brusselle,G.G., Burkart,K.M., Chen,T.H., Couper,D.,
            Crapo,J.D., Davies,G., Dupuis,J., Franceschini,N., Gulsvik,A.,
            Hancock,D.B., Harris,T.B., Hofman,A., Imboden,M., James,A.L.,
            Khaw,K.T., Lahousse,L., Launer,L.J., Litonjua,A., Liu,Y.,
            Lohman,K.K., Lomas,D.A., Lumley,T., Marciante,K.D., McArdle,W.L.,
            Meibohm,B., Morrison,A.C., Musk,A.W., Myers,R.H., North,K.E.,
            Postma,D.S., Psaty,B.M., Rich,S.S., Rivadeneira,F., Rochat,T.,
            Rotter,J.I., Artigas,M.S., Starr,J.M., Uitterlinden,A.G.,
            Wareham,N.J., Wijmenga,C., Zanen,P., Province,M.A., Silverman,E.K.,
            Deary,I.J., Palmer,L.J., Cassano,P.A., Gudnason,V., Barr,R.G.,
            Loos,R.J., Strachan,D.P., London,S.J., Boezen,H.M.,
            Probst-Hensch,N., Gharib,S.A., Hall,I.P., O'Connor,G.T., Tobin,M.D.
            and Stricker,B.H.
  TITLE     Genome-wide association studies identify CHRNA5/3 and HTR4 in the
            development of airflow obstruction
  JOURNAL   Am. J. Respir. Crit. Care Med. 186 (7), 622-632 (2012)
   PUBMED   22837378
REFERENCE   3  (bases 1 to 2908)
  AUTHORS   Sinner,M.F., Porthan,K., Noseworthy,P.A., Havulinna,A.S.,
            Tikkanen,J.T., Muller-Nurasyid,M., Peloso,G., Ulivi,S.,
            Beckmann,B.M., Brockhaus,A.C., Cooper,R.R., Gasparini,P.,
            Hengstenberg,C., Hwang,S.J., Iorio,A., Junttila,M.J., Klopp,N.,
            Kahonen,M., Laaksonen,M.A., Lehtimaki,T., Lichtner,P.,
            Lyytikainen,L.P., Martens,E., Meisinger,C., Meitinger,T.,
            Merchant,F.M., Nieminen,M.S., Peters,A., Pietila,A., Perz,S.,
            Oikarinen,L., Raitakari,O., Reinhard,W., Silander,K., Thorand,B.,
            Wichmann,H.E., Sinagra,G., Viikari,J., O'Donnell,C.J.,
            Ellinor,P.T., Huikuri,H.V., Kaab,S., Newton-Cheh,C. and Salomaa,V.
  TITLE     A meta-analysis of genome-wide association studies of the
            electrocardiographic early repolarization pattern
  JOURNAL   Heart Rhythm 9 (10), 1627-1634 (2012)
   PUBMED   22683750
REFERENCE   4  (bases 1 to 2908)
  AUTHORS   Comuzzie,A.G., Cole,S.A., Laston,S.L., Voruganti,V.S., Haack,K.,
            Gibbs,R.A. and Butte,N.F.
  TITLE     Novel genetic loci identified for the pathophysiology of childhood
            obesity in the Hispanic population
  JOURNAL   PLoS ONE 7 (12), E51954 (2012)
   PUBMED   23251661
REFERENCE   5  (bases 1 to 2908)
  AUTHORS   Li,J., Mo,M., Chen,Z., Chen,Z., Sheng,Q., Mu,H., Zhang,F.,
            Zhang,Y., Zhi,X.Y., Li,H., He,B. and Zhou,H.M.
  TITLE     Adenoviral delivery of the EMX2 gene suppresses growth in human
            gastric cancer
  JOURNAL   PLoS ONE 7 (9), E45970 (2012)
   PUBMED   23029345
  REMARK    GeneRIF: EMX2 expression led to inhibition of cell proliferation
            and Wnt signaling pathway both in vitro and in a gastric cancer
            xenograft model in vivo.
REFERENCE   6  (bases 1 to 2908)
  AUTHORS   Guerrini,R. and Carrozzo,R.
  TITLE     Epileptogenic brain malformations: clinical presentation,
            malformative patterns and indications for genetic testing
  JOURNAL   Seizure 11 (SUPPL A), 532-543 (2002)
   PUBMED   12185771
  REMARK    GeneRIF: EMX2 gene has been reported in schezencephaly (cleft
            brain) including epilepsy in some patients.
            Review article
REFERENCE   7  (bases 1 to 2908)
  AUTHORS   Noonan,F.C., Mutch,D.G., Ann Mallon,M. and Goodfellow,P.J.
  TITLE     Characterization of the homeodomain gene EMX2: sequence
            conservation, expression analysis, and a search for mutations in
            endometrial cancers
  JOURNAL   Genomics 76 (1-3), 37-44 (2001)
   PUBMED   11549315
REFERENCE   8  (bases 1 to 2908)
  AUTHORS   Brunelli,S., Faiella,A., Capra,V., Nigro,V., Simeone,A., Cama,A.
            and Boncinelli,E.
  TITLE     Germline mutations in the homeobox gene EMX2 in patients with
            severe schizencephaly
  JOURNAL   Nat. Genet. 12 (1), 94-96 (1996)
   PUBMED   8528262
REFERENCE   9  (bases 1 to 2908)
  AUTHORS   Kastury,K., Druck,T., Huebner,K., Barletta,C., Acampora,D.,
            Simeone,A., Faiella,A. and Boncinelli,E.
  TITLE     Chromosome locations of human EMX and OTX genes
  JOURNAL   Genomics 22 (1), 41-45 (1994)
   PUBMED   7959790
REFERENCE   10 (bases 1 to 2908)
  AUTHORS   Simeone,A., Gulisano,M., Acampora,D., Stornaiuolo,A., Rambaldi,M.
            and Boncinelli,E.
  TITLE     Two vertebrate homeobox genes related to the Drosophila empty
            spiracles gene are expressed in the embryonic cerebral cortex
  JOURNAL   EMBO J. 11 (7), 2541-2550 (1992)
   PUBMED   1352754
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AF301598.1 and AI701984.1.
            This sequence is a reference standard in the RefSeqGene project.
            On Jan 11, 2008 this sequence version replaced gi:31542586.
            
            Summary: This gene encodes a homeobox-containing transcription
            factor that is the homolog to the 'empty spiracles' gene in
            Drosophila. Research on this gene in humans has focused on its
            expression in three tissues: dorsal telencephalon, olfactory
            neuroepithelium, and urogenetial system. It is expressed in the
            dorsal telencephalon during development in a low rostral-lateral to
            high caudal-medial gradient and is proposed to pattern the
            neocortex into defined functional areas. It is also expressed in
            embryonic and adult olfactory neuroepithelia where it complexes
            with eukaryotic translation initiation factor 4E (eIF4E) and
            possibly regulates mRNA transport or translation. In the developing
            urogenital system, it is expressed in epithelial tissues and is
            negatively regulated by HOXA10. Alternative splicing results in
            multiple transcript variants encoding distinct proteins.[provided
            by RefSeq, Sep 2009].
            
            Transcript Variant: This variant (1) represents the longer
            transcript and encodes the longer isoform (1).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF301598.1, AK055041.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-2892              AF301598.1         1-2892
            2893-2908           AI701984.1         1-16                c
FEATURES             Location/Qualifiers
     source          1..2908
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="10"
                     /map="10q26.1"
     gene            1..2908
                     /gene="EMX2"
                     /note="empty spiracles homeobox 2"
                     /db_xref="GeneID:2018"
                     /db_xref="HGNC:3341"
                     /db_xref="HPRD:02495"
                     /db_xref="MIM:600035"
     exon            1..1229
                     /gene="EMX2"
                     /inference="alignment:Splign:1.39.8"
     variation       150
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12777466"
     variation       187
                     /gene="EMX2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375090740"
     variation       268
                     /gene="EMX2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:193287673"
     misc_feature    284..286
                     /gene="EMX2"
                     /note="upstream in-frame stop codon"
     variation       386..387
                     /gene="EMX2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:368535750"
     variation       423
                     /gene="EMX2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375486605"
     variation       456
                     /gene="EMX2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12777755"
     variation       470
                     /gene="EMX2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:71013666"
     variation       488
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:60309535"
     variation       494
                     /gene="EMX2"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:374002074"
     variation       645
                     /gene="EMX2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372863199"
     variation       659
                     /gene="EMX2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12784456"
     variation       688..693
                     /gene="EMX2"
                     /replace=""
                     /replace="ccccca"
                     /db_xref="dbSNP:149284992"
     STS             728..2000
                     /gene="EMX2"
                     /db_xref="UniSTS:481530"
     variation       737
                     /gene="EMX2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369213869"
     variation       778
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:8192643"
     STS             779..1618
                     /gene="EMX2"
                     /db_xref="UniSTS:482320"
     CDS             824..1582
                     /gene="EMX2"
                     /note="isoform 1 is encoded by transcript variant 1; empty
                     spiracles-like protein 2; homeobox protein EMX2; empty
                     spiracles homolog 2"
                     /codon_start=1
                     /product="homeobox protein EMX2 isoform 1"
                     /protein_id="NP_004089.1"
                     /db_xref="GI:14149611"
                     /db_xref="CCDS:CCDS7601.1"
                     /db_xref="GeneID:2018"
                     /db_xref="HGNC:3341"
                     /db_xref="HPRD:02495"
                     /db_xref="MIM:600035"
                     /translation="

MFQPAPKRCFTIESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRGVYSNPDLVFAEAVSHPPNPAVPVHPVPPPHALAAHPLPSSHSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLEEEGSDSQQKKKGTHHINRWRIATKQASPEEIDVTSDD

"
     misc_feature    1286..1462
                     /gene="EMX2"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(1286..1300,1304..1306,1355..1357,1373..1375,
                     1412..1414,1418..1423,1430..1435,1439..1447,1451..1456)
                     /gene="EMX2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(1292..1294,1301..1303,1421..1423,1430..1435,
                     1442..1444)
                     /gene="EMX2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     variation       836
                     /gene="EMX2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371549541"
     variation       865
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375691102"
     variation       893
                     /gene="EMX2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369744669"
     variation       916
                     /gene="EMX2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146160041"
     variation       928
                     /gene="EMX2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:373030604"
     variation       944
                     /gene="EMX2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140164453"
     variation       961
                     /gene="EMX2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:377504325"
     variation       1069
                     /gene="EMX2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371177025"
     variation       1079
                     /gene="EMX2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113852997"
     variation       1082
                     /gene="EMX2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200918900"
     variation       1095
                     /gene="EMX2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200357168"
     variation       1114
                     /gene="EMX2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:149834474"
     variation       1144
                     /gene="EMX2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376153573"
     variation       1161
                     /gene="EMX2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:370537063"
     variation       1171
                     /gene="EMX2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144775289"
     STS             1175..1564
                     /gene="EMX2"
                     /standard_name="Emx2"
                     /db_xref="UniSTS:530684"
     variation       1198
                     /gene="EMX2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148439570"
     exon            1230..1414
                     /gene="EMX2"
                     /inference="alignment:Splign:1.39.8"
     variation       1289
                     /gene="EMX2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:8192642"
     variation       1325
                     /gene="EMX2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:147576243"
     variation       1358
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371880298"
     variation       1367
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141981608"
     variation       1369
                     /gene="EMX2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:424112"
     exon            1415..2896
                     /gene="EMX2"
                     /inference="alignment:Splign:1.39.8"
     variation       1476
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200981903"
     variation       1545
                     /gene="EMX2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376235349"
     variation       1548
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147858760"
     variation       1608
                     /gene="EMX2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146762820"
     variation       1616
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:56407327"
     variation       1618
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376621996"
     variation       1619..1620
                     /gene="EMX2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:35212038"
     variation       1691
                     /gene="EMX2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139391042"
     variation       1700
                     /gene="EMX2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:191919707"
     STS             1754..1957
                     /gene="EMX2"
                     /standard_name="Emx2"
                     /db_xref="UniSTS:142986"
     variation       1881
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11814647"
     variation       1888
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11814648"
     variation       1892
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11818517"
     variation       1898
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11814649"
     variation       1899..1902
                     /gene="EMX2"
                     /replace=""
                     /replace="agag"
                     /db_xref="dbSNP:66710107"
     variation       1899..1900
                     /gene="EMX2"
                     /replace=""
                     /replace="ag"
                     /db_xref="dbSNP:113566709"
     variation       1901..1904
                     /gene="EMX2"
                     /replace=""
                     /replace="agag"
                     /db_xref="dbSNP:34929200"
     variation       1902..1905
                     /gene="EMX2"
                     /replace=""
                     /replace="gaga"
                     /db_xref="dbSNP:146292406"
     variation       1902
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11818518"
     variation       1914
                     /gene="EMX2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:56380433"
     variation       1920..1923
                     /gene="EMX2"
                     /replace=""
                     /replace="gaga"
                     /db_xref="dbSNP:55851441"
     variation       1928
                     /gene="EMX2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:447520"
     variation       2143
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374374688"
     variation       2173
                     /gene="EMX2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:72541118"
     variation       2207
                     /gene="EMX2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143671290"
     variation       2255
                     /gene="EMX2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:75535495"
     variation       2385
                     /gene="EMX2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374436349"
     variation       2416
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371551174"
     variation       2460
                     /gene="EMX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182380025"
     variation       2498
                     /gene="EMX2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:148079404"
     variation       2507
                     /gene="EMX2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187010704"
     variation       2581
                     /gene="EMX2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141898399"
     STS             2656..2862
                     /gene="EMX2"
                     /standard_name="STS-AA025104"
                     /db_xref="UniSTS:21044"
     variation       2783
                     /gene="EMX2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41284394"
ORIGIN      

cgggcgccgcaggagcgagtgagctgggagcgaggggcgaaggcgcggagaagcccggccgcccggtgggcggcagaaggctcagccgaggcggcggcgccgactccgttccactctcggcccggatccaggcctccgggttcccaggcgctcacctccctctgacgcactttaaagagtctccccccttccacctcagggcgagtaatagcgaccaatcatcaagccatttaccaggcttcggaggaagctgtttatgtgatccccgcactaattaggctcatgaactaacaaatcgtttgcacaacttgtgaagaagcgaacacttccatggattgtccttggacttagggcgccctgcccgccttttgcagaggagaaaaaacttttttttttttttgcctcccccgagaactttccccccttctcctccctgcctctaactccgatccccccacgccatctcgccaaaaaaaaaaaaaaaaaaaaaaaagaaaaaaaaagaaaaaaaaagaaaaaaaattaccccaatccacgcctgcaaattcttctggaaggattttcccccctctcttcaggttgggcgcgtttggtgcaagattctcgggatcctcggctttgcctctccctctccctcccccctcctttcctttttcctttcctttcctttctttcttcctttccttccccccacccccacccccaccccaaacaaacgagtccccaattctcgtccgtcctcgccgcgggcagcgggcggcggaggcagcgtgcggcggtcgccaggagctgggagcccagggcgcccgctcctcggcgcagcatgttccagccggcgcccaagcgctgcttcaccatcgagtcgctggtggccaaggacagtcccctgcccgcctcgcgctccgaggaccccatccgtcccgcggcactcagctacgctaactccagccccataaatccgttcctcaacggcttccactcggccgccgccgccgccgccggtaggggcgtctactccaacccggacttggtgttcgccgaggcggtctcgcacccgcccaaccccgccgtgccagtgcacccggtgccgccgccgcacgccctggccgcccaccccctaccctcctcgcactcgccacaccccctattcgcctcgcagcagcgggatccgtccaccttctacccctggctcatccaccgctaccgatatctgggtcatcgcttccaagggaacgacactagccccgagagtttccttttgcacaacgcgctggcccgaaagcccaagcggatccgaaccgccttctccccgtcccagcttctaaggctggaacacgcctttgagaagaatcactacgtggtgggcgccgaaaggaagcagctggcacacagcctcagcctcacggaaactcaggtaaaagtatggtttcagaaccgaagaacaaagttcaaaaggcagaagctggaggaagaaggctcagattcgcaacaaaagaaaaaagggacgcaccatattaaccggtggagaatcgccaccaagcaggcgagtccggaggaaatagacgtgacctcagatgattaaaaacataaacctaaccccacagaaacggacaacatggagcaaaagagacagggagaggtggagaaggaaaaaaccctacaaaacaaaaacaaaccgcatacacgttcaccgagaaagggagagggaatcggagggagcagcggaatgcggcgaagactctggacagcgagggcacagggtcccaaaccgaggccgcgccaagatggcagaggatggaggctccttcatcaacaagcgaccctcgtctaaagaggcagctgagtgagagacacagagagaaggagaaagagggagggagagagagaaagagagagaaagagagagagagagagagagagagaaagctgaacgtgcactctgacaaggggagctgtcaatcaaacaccaaaccggggagacaagatgattggcaggtattccgtttatcacagtccacttaaaaaatgatgatgatgataaaaaccacgacccaaccaggcacaggacttttttgttttttgcacttcgctgtgtttcccccccatctttaaaaataattagtaataaaaaacaaaaattccatatctagccccatcccacacctgtttcaaatccttgaaatgcatgtagcagttgttgggcgaatggtgtttaaagaccgaaaatgaattgtaattttcttttccttttaaagacaggttctgtgtgctttttattttgattttttttcccaagaaatgtgcagtctgtaaacactttttgataccttctgatgtcaaagtgattgtgcaagctaaatgaagtaggctcagcgatagtggtcctcttacagagaaacggggagcaggacgacgggggggctgggggtggcgggggagggtgcccacaaaaagaatcaggacttgtactgggaaaaaaacccctaaattaattatatttcttggacattccctttcctaacatcctgaggcttaaaaccctgatgcaaacttctcctttcagtggttggagaaattggccgagttcaaccattcactgcaatgcctattccaaactttaaatctatctattgcaaaacctgaaggactgtagttagcggggatgatgttaagtgtggccaagcgcacggcggcaagttttcaagcactgagtttctattccaagatcatagacttactaaagagagtgacaaatgcttccttaatgtcttctataccagaatgtaaatatttttgtgttttgtgttaatttgttagaattctaacacactatatacttccaagaagtatgtcaatgtcaatattttgtcaataaagatttatcaatatgccctcaaaaaaaaaaaaa

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:2018 -> Molecular function: GO:0000976 [transcription regulatory region sequence-specific DNA binding] evidence: IEA
            GeneID:2018 -> Molecular function: GO:0003677 [DNA binding] evidence: NAS
            GeneID:2018 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:2018 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:2018 -> Biological process: GO:0007275 [multicellular organismal development] evidence: NAS
            GeneID:2018 -> Biological process: GO:0009952 [anterior/posterior pattern specification] evidence: IEA
            GeneID:2018 -> Biological process: GO:0021542 [dentate gyrus development] evidence: IEA
            GeneID:2018 -> Biological process: GO:0021796 [cerebral cortex regionalization] evidence: IEA
            GeneID:2018 -> Biological process: GO:0021846 [cell proliferation in forebrain] evidence: IEA
            GeneID:2018 -> Biological process: GO:0021885 [forebrain cell migration] evidence: IEA
            GeneID:2018 -> Biological process: GO:0030182 [neuron differentiation] evidence: IEA
            GeneID:2018 -> Biological process: GO:0042493 [response to drug] evidence: IEA
            GeneID:2018 -> Biological process: GO:0072001 [renal system development] evidence: IEA
            GeneID:2018 -> Cellular component: GO:0005634 [nucleus] evidence: NAS