2024-04-24 07:19:39, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004057 453 bp mRNA linear PRI 29-APR-2013 DEFINITION Homo sapiens S100 calcium binding protein G (S100G), mRNA. ACCESSION NM_004057 VERSION NM_004057.2 GI:112382245 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 453) AUTHORS Fukushima,A., Aizaki,Y. and Sakuma,K. TITLE Short-chain fatty acids increase the level of calbindin-D9k messenger RNA in Caco-2 cells JOURNAL J. Nutr. Sci. Vitaminol. 58 (4), 287-291 (2012) PUBMED 23132313 REMARK GeneRIF: Addition of short-chain fatty acids to cultured Caco-2 cells results in elevation of calbindin-D9k mRNA. REFERENCE 2 (bases 1 to 453) AUTHORS Halhali,A., Figueras,A.G., Diaz,L., Avila,E., Barrera,D., Hernandez,G. and Larrea,F. TITLE Effects of calcitriol on calbindins gene expression and lipid peroxidation in human placenta JOURNAL J. Steroid Biochem. Mol. Biol. 121 (1-2), 448-451 (2010) PUBMED 20214988 REMARK GeneRIF: cultured syncytiotrophoblast cells express calbindin-D9k and calbindin-D28k genes, which are stimulated by calcitriol REFERENCE 3 (bases 1 to 453) AUTHORS Mao,X., Mao,Z. and Huo,Z. TITLE [Effect of parathyroid hormone and 1,25-(OH)2-D3 on the expression of the mRNA of calbindin D9k in Caco-2 cells] JOURNAL Wei Sheng Yan Jiu 36 (3), 372-375 (2007) PUBMED 17712966 REMARK GeneRIF: Parathyroid hormone may inhibit or counteract the increase in CaBP-D9k mRNA caused by 1,25-(OH)2-D3 in Caco-2 cells. REFERENCE 4 (bases 1 to 453) AUTHORS Ross,M.T., Grafham,D.V., Coffey,A.J., Scherer,S., McLay,K., Muzny,D., Platzer,M., Howell,G.R., Burrows,C., Bird,C.P., Frankish,A., Lovell,F.L., Howe,K.L., Ashurst,J.L., Fulton,R.S., Sudbrak,R., Wen,G., Jones,M.C., Hurles,M.E., Andrews,T.D., Scott,C.E., Searle,S., Ramser,J., Whittaker,A., Deadman,R., Carter,N.P., Hunt,S.E., Chen,R., Cree,A., Gunaratne,P., Havlak,P., Hodgson,A., Metzker,M.L., Richards,S., Scott,G., Steffen,D., Sodergren,E., Wheeler,D.A., Worley,K.C., Ainscough,R., Ambrose,K.D., Ansari-Lari,M.A., Aradhya,S., Ashwell,R.I., Babbage,A.K., Bagguley,C.L., Ballabio,A., Banerjee,R., Barker,G.E., Barlow,K.F., Barrett,I.P., Bates,K.N., Beare,D.M., Beasley,H., Beasley,O., Beck,A., Bethel,G., Blechschmidt,K., Brady,N., Bray-Allen,S., Bridgeman,A.M., Brown,A.J., Brown,M.J., Bonnin,D., Bruford,E.A., Buhay,C., Burch,P., Burford,D., Burgess,J., Burrill,W., Burton,J., Bye,J.M., Carder,C., Carrel,L., Chako,J., Chapman,J.C., Chavez,D., Chen,E., Chen,G., Chen,Y., Chen,Z., Chinault,C., Ciccodicola,A., Clark,S.Y., Clarke,G., Clee,C.M., Clegg,S., Clerc-Blankenburg,K., Clifford,K., Cobley,V., Cole,C.G., Conquer,J.S., Corby,N., Connor,R.E., David,R., Davies,J., Davis,C., Davis,J., Delgado,O., Deshazo,D., Dhami,P., Ding,Y., Dinh,H., Dodsworth,S., Draper,H., Dugan-Rocha,S., Dunham,A., Dunn,M., Durbin,K.J., Dutta,I., Eades,T., Ellwood,M., Emery-Cohen,A., Errington,H., Evans,K.L., Faulkner,L., Francis,F., Frankland,J., Fraser,A.E., Galgoczy,P., Gilbert,J., Gill,R., Glockner,G., Gregory,S.G., Gribble,S., Griffiths,C., Grocock,R., Gu,Y., Gwilliam,R., Hamilton,C., Hart,E.A., Hawes,A., Heath,P.D., Heitmann,K., Hennig,S., Hernandez,J., Hinzmann,B., Ho,S., Hoffs,M., Howden,P.J., Huckle,E.J., Hume,J., Hunt,P.J., Hunt,A.R., Isherwood,J., Jacob,L., Johnson,D., Jones,S., de Jong,P.J., Joseph,S.S., Keenan,S., Kelly,S., Kershaw,J.K., Khan,Z., Kioschis,P., Klages,S., Knights,A.J., Kosiura,A., Kovar-Smith,C., Laird,G.K., Langford,C., Lawlor,S., Leversha,M., Lewis,L., Liu,W., Lloyd,C., Lloyd,D.M., Loulseged,H., Loveland,J.E., Lovell,J.D., Lozado,R., Lu,J., Lyne,R., Ma,J., Maheshwari,M., Matthews,L.H., McDowall,J., McLaren,S., McMurray,A., Meidl,P., Meitinger,T., Milne,S., Miner,G., Mistry,S.L., Morgan,M., Morris,S., Muller,I., Mullikin,J.C., Nguyen,N., Nordsiek,G., Nyakatura,G., O'Dell,C.N., Okwuonu,G., Palmer,S., Pandian,R., Parker,D., Parrish,J., Pasternak,S., Patel,D., Pearce,A.V., Pearson,D.M., Pelan,S.E., Perez,L., Porter,K.M., Ramsey,Y., Reichwald,K., Rhodes,S., Ridler,K.A., Schlessinger,D., Schueler,M.G., Sehra,H.K., Shaw-Smith,C., Shen,H., Sheridan,E.M., Shownkeen,R., Skuce,C.D., Smith,M.L., Sotheran,E.C., Steingruber,H.E., Steward,C.A., Storey,R., Swann,R.M., Swarbreck,D., Tabor,P.E., Taudien,S., Taylor,T., Teague,B., Thomas,K., Thorpe,A., Timms,K., Tracey,A., Trevanion,S., Tromans,A.C., d'Urso,M., Verduzco,D., Villasana,D., Waldron,L., Wall,M., Wang,Q., Warren,J., Warry,G.L., Wei,X., West,A., Whitehead,S.L., Whiteley,M.N., Wilkinson,J.E., Willey,D.L., Williams,G., Williams,L., Williamson,A., Williamson,H., Wilming,L., Woodmansey,R.L., Wray,P.W., Yen,J., Zhang,J., Zhou,J., Zoghbi,H., Zorilla,S., Buck,D., Reinhardt,R., Poustka,A., Rosenthal,A., Lehrach,H., Meindl,A., Minx,P.J., Hillier,L.W., Willard,H.F., Wilson,R.K., Waterston,R.H., Rice,C.M., Vaudin,M., Coulson,A., Nelson,D.L., Weinstock,G., Sulston,J.E., Durbin,R., Hubbard,T., Gibbs,R.A., Beck,S., Rogers,J. and Bentley,D.R. TITLE The DNA sequence of the human X chromosome JOURNAL Nature 434 (7031), 325-337 (2005) PUBMED 15772651 REFERENCE 5 (bases 1 to 453) AUTHORS Wang,L., Klopot,A., Freund,J.N., Dowling,L.N., Krasinski,S.D. and Fleet,J.C. TITLE Control of differentiation-induced calbindin-D9k gene expression in Caco-2 cells by cdx-2 and HNF-1alpha JOURNAL Am. J. Physiol. Gastrointest. Liver Physiol. 287 (5), G943-G953 (2004) PUBMED 15217781 REMARK GeneRIF: Cdx-2 is a permissive factor that influences basal CaBP expression in enterocytes and that HNF-1alpha modulates CaBP gene expression during cellular differentiation. REFERENCE 6 (bases 1 to 453) AUTHORS Fleet,J.C. and Hock,J.M. TITLE Identification of osteocalcin mRNA in nonosteoid tissue of rats and humans by reverse transcription-polymerase chain reaction JOURNAL J. Bone Miner. Res. 9 (10), 1565-1573 (1994) PUBMED 7817802 REFERENCE 7 (bases 1 to 453) AUTHORS Miller,E.K., Word,R.A., Goodall,C.A. and Iacopino,A.M. TITLE Calbindin-D9K gene expression in human myometrium during pregnancy and labor JOURNAL J. Clin. Endocrinol. Metab. 79 (2), 609-615 (1994) PUBMED 8045984 REFERENCE 8 (bases 1 to 453) AUTHORS Jeung,E.B., Krisinger,J., Dann,J.L. and Leung,P.C. TITLE Molecular cloning of the full-length cDNA encoding the human calbindin-D9k JOURNAL FEBS Lett. 307 (2), 224-228 (1992) PUBMED 1379540 REFERENCE 9 (bases 1 to 453) AUTHORS Howard,A., Legon,S., Spurr,N.K. and Walters,J.R. TITLE Molecular cloning and chromosomal assignment of human calbindin-D9k JOURNAL Biochem. Biophys. Res. Commun. 185 (2), 663-669 (1992) PUBMED 1610358 REFERENCE 10 (bases 1 to 453) AUTHORS Balmain,N. TITLE Calbindin-D9k. A vitamin-D-dependent, calcium-binding protein in mineralized tissues JOURNAL Clin. Orthop. Relat. Res. 265, 265-276 (1991) PUBMED 2009668 REMARK Review article COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from L13220.1. On Aug 16, 2006 this sequence version replaced gi:4757897. Summary: This gene encodes calbindin D9K, a vitamin D-dependent calcium-binding protein. This cytosolic protein belongs to a family of calcium-binding proteins that includes calmodulin, parvalbumin, troponin C, and S100 protein. In the intestine, the protein is vitamin D-dependent and its expression correlates with calcium transport activity. The protein may increase Ca2+ absorption by buffering Ca2+ in the cytoplasm and increase ATP-dependent Ca2+ transport in duodenal basolateral membrane vesicles. [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: L13220.1, BC112174.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-453 L13220.1 4-456 FEATURES Location/Qualifiers source 1..453 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="X" /map="Xp22.2" gene 1..453 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /note="S100 calcium binding protein G" /db_xref="GeneID:795" /db_xref="HGNC:1436" /db_xref="HPRD:02360" /db_xref="MIM:302020" exon 1..46 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /inference="alignment:Splign:1.39.8" variation 15 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:184900887" STS 35..343 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /db_xref="UniSTS:483420" exon 47..189 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /inference="alignment:Splign:1.39.8" variation 48 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:41311513" CDS 55..294 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /note="calbindin D9K; calbindin-D9K; calbindin 3, (vitamin D-dependent calcium-binding protein); S100 calcium-binding protein G; vitamin D-dependent calcium-binding protein, intestinal" /codon_start=1 /product="protein S100-G" /protein_id="NP_004048.1" /db_xref="GI:4757898" /db_xref="CCDS:CCDS14176.1" /db_xref="GeneID:795" /db_xref="HGNC:1436" /db_xref="HPRD:02360" /db_xref="MIM:302020" /translation="
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ
" misc_feature 67..291 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /note="S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif. Note that this S-100 hierarchy contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100...; Region: S-100; cd00213" /db_xref="CDD:88292" misc_feature order(67..108,124..132,157..162,166..174,247..258, 262..267,271..282,286..291) /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /note="dimerization interface [polypeptide binding]; other site" /db_xref="CDD:88292" misc_feature order(106..108,121..123,130..132,145..150,226..228, 232..234,238..240,244..246,250..252,259..261) /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:88292" misc_feature 127..282 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /note="EF-hand domain pair; Region: EF_hand_6; pfam13833" /db_xref="CDD:206004" variation 62 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:369636673" variation 136 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="t" /db_xref="dbSNP:192512496" exon 190..453 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /inference="alignment:Splign:1.39.8" variation 190 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="g" /db_xref="dbSNP:200041601" STS 221..383 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /standard_name="GDB:604580" /db_xref="UniSTS:98889" variation 256 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:199885083" variation 260 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="c" /db_xref="dbSNP:145104796" variation 264 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:375477819" variation 296 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:186822909" variation 297 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:144139570" STS 307..416 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /standard_name="RH1707" /db_xref="UniSTS:5495" variation 335 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:201526472" variation 337 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:6629164" polyA_signal 433..438 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" polyA_site 453 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" ORIGIN
aaactcctctttgattcttctagctgtttcactattgggcaaccagacaccagaatgagtactaaaaagtctcctgaggaactgaagaggatttttgaaaaatatgcagccaaagaaggtgatccagaccagttgtcaaaggatgaactgaagctattgattcaggctgaattccccagtttactcaaaggtccaaacaccctagatgatctctttcaagaactggacaagaatggagatggagaagttagttttgaagaattccaagtattagtaaaaaagatatcccagtgaaggagaaaacaaaatagaaccctgagcactggaggaagagcgcctgtgctgtggtcttatcctatgtggaatcccccaaagtctctggtttaattctttgcaattataataacctggctgtgaggttcagttattattaataaagaaattattagacat
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:795 -> Molecular function: GO:0005499 [vitamin D binding] evidence: IEA GeneID:795 -> Molecular function: GO:0005509 [calcium ion binding] evidence: IEA GeneID:795 -> Cellular component: GO:0016323 [basolateral plasma membrane] evidence: IEA GeneID:795 -> Cellular component: GO:0016324 [apical plasma membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.