GGRNA Home | Help | Advanced search

2024-03-29 00:29:06, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_003953               5026 bp    mRNA    linear   PRI 14-APR-2013
DEFINITION  Homo sapiens myelin protein zero-like 1 (MPZL1), transcript variant
            1, mRNA.
ACCESSION   NM_003953
VERSION     NM_003953.5  GI:226054531
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 5026)
  AUTHORS   Cummings,A.C., Jiang,L., Velez Edwards,D.R., McCauley,J.L.,
            Laux,R., McFarland,L.L., Fuzzell,D., Knebusch,C., Caywood,L.,
            Reinhart-Mercer,L., Nations,L., Gilbert,J.R., Konidari,I.,
            Tramontana,M., Cuccaro,M.L., Scott,W.K., Pericak-Vance,M.A. and
            Haines,J.L.
  TITLE     Genome-wide association and linkage study in the Amish detects a
            novel candidate late-onset Alzheimer disease gene
  JOURNAL   Ann. Hum. Genet. 76 (5), 342-351 (2012)
   PUBMED   22881374
REFERENCE   2  (bases 1 to 5026)
  AUTHORS   Gallardo,E., Garcia,A., Ramon,C., Maravi,E., Infante,J., Gaston,I.,
            Alonso,A., Combarros,O., De Jonghe,P. and Berciano,J.
  TITLE     Charcot-Marie-Tooth disease type 2J with MPZ Thr124Met mutation:
            clinico-electrophysiological and MRI study of a family
  JOURNAL   J. Neurol. 256 (12), 2061-2071 (2009)
   PUBMED   19629567
  REMARK    GeneRIF: Clinico-electrophysiological features and MRI findings are
            described in leg musculature from three patients belonging to a
            CMT2J pedigree due to MPZ Thr124Met mutation.
REFERENCE   3  (bases 1 to 5026)
  AUTHORS   Ehret,G.B., O'Connor,A.A., Weder,A., Cooper,R.S. and Chakravarti,A.
  TITLE     Follow-up of a major linkage peak on chromosome 1 reveals
            suggestive QTLs associated with essential hypertension: GenNet
            study
  JOURNAL   Eur. J. Hum. Genet. 17 (12), 1650-1657 (2009)
   PUBMED   19536175
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   4  (bases 1 to 5026)
  AUTHORS   Cheung,C.L., Chan,B.Y., Chan,V., Ikegawa,S., Kou,I., Ngai,H.,
            Smith,D., Luk,K.D., Huang,Q.Y., Mori,S., Sham,P.C. and Kung,A.W.
  TITLE     Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible
            genetic association with bone mineral density variation
  JOURNAL   Hum. Mol. Genet. 18 (4), 679-687 (2009)
   PUBMED   19064610
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   5  (bases 1 to 5026)
  AUTHORS   Kusano,K., Thomas,T.N. and Fujiwara,K.
  TITLE     Phosphorylation and localization of protein-zero related (PZR) in
            cultured endothelial cells
  JOURNAL   Endothelium 15 (3), 127-136 (2008)
   PUBMED   18568953
  REMARK    GeneRIF: Phosphorylation and localization of PZR in cultured
            endothelial cells is reported.
REFERENCE   6  (bases 1 to 5026)
  AUTHORS   Wistow,G., Bernstein,S.L., Wyatt,M.K., Fariss,R.N., Behal,A.,
            Touchman,J.W., Bouffard,G., Smith,D. and Peterson,K.
  TITLE     Expressed sequence tag analysis of human RPE/choroid for the
            NEIBank Project: over 6000 non-redundant transcripts, novel genes
            and splice variants
  JOURNAL   Mol. Vis. 8, 205-220 (2002)
   PUBMED   12107410
  REMARK    Publication Status: Online-Only
REFERENCE   7  (bases 1 to 5026)
  AUTHORS   Zhao,R., Guerrah,A., Tang,H. and Zhao,Z.J.
  TITLE     Cell surface glycoprotein PZR is a major mediator of concanavalin
            A-induced cell signaling
  JOURNAL   J. Biol. Chem. 277 (10), 7882-7888 (2002)
   PUBMED   11751924
  REMARK    GeneRIF: PZR is a major receptor of ConA and has an important role
            in cell signaling via c-Src. Considering the various biological
            activities of ConA, the study of PZR may have major therapeutic
            implications
REFERENCE   8  (bases 1 to 5026)
  AUTHORS   Zhao,R. and Zhao,Z.J.
  TITLE     Dissecting the interaction of SHP-2 with PZR, an immunoglobulin
            family protein containing immunoreceptor tyrosine-based inhibitory
            motifs
  JOURNAL   J. Biol. Chem. 275 (8), 5453-5459 (2000)
   PUBMED   10681522
REFERENCE   9  (bases 1 to 5026)
  AUTHORS   Tang,D.S., Yu,K.P., Tang,X.X., Zhang,H.L., Pan,Q., Dai,H.P. and
            Xia,J.H.
  TITLE     Cloning of Human Myelin Protein Zero-like Genes by Bioinformatics
            Strategy
  JOURNAL   Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 32 (4), 364-368 (2000)
   PUBMED   12075424
REFERENCE   10 (bases 1 to 5026)
  AUTHORS   Zhao,Z.J. and Zhao,R.
  TITLE     Purification and cloning of PZR, a binding protein and putative
            physiological substrate of tyrosine phosphatase SHP-2
  JOURNAL   J. Biol. Chem. 273 (45), 29367-29372 (1998)
   PUBMED   9792637
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DA725074.1, AY359019.1, Z99943.1 and AW292498.1.
            On Apr 1, 2009 this sequence version replaced gi:46358424.
            
            Transcript Variant: This variant (1) represents the longest
            transcript and encodes the longest isoform (a).
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK075334.1, AY359019.1 [ECO:0000332]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-40                DA725074.1         1-40
            41-1817             AY359019.1         1-1777
            1818-4719           Z99943.1           65024-67925
            4720-5026           AW292498.1         1-307               c
FEATURES             Location/Qualifiers
     source          1..5026
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q24.2"
     gene            1..5026
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /note="myelin protein zero-like 1"
                     /db_xref="GeneID:9019"
                     /db_xref="HGNC:7226"
                     /db_xref="HPRD:05086"
                     /db_xref="MIM:604376"
     exon            1..293
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="alignment:Splign:1.39.8"
     CDS             203..1012
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /note="isoform a precursor is encoded by transcript
                     variant 1; protein zero related; myelin protein zero-like
                     protein 1; immunoglobulin family transmembrane protein;
                     protein zero-related"
                     /codon_start=1
                     /product="myelin protein zero-like protein 1 isoform a
                     precursor"
                     /protein_id="NP_003944.1"
                     /db_xref="GI:4506357"
                     /db_xref="CCDS:CCDS1264.1"
                     /db_xref="GeneID:9019"
                     /db_xref="HGNC:7226"
                     /db_xref="HPRD:05086"
                     /db_xref="MIM:604376"
                     /translation="
MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
"
     sig_peptide     203..307
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Potential; propagated from UniProtKB/Swiss-Prot
                     (O95297.1)"
     mat_peptide     308..1009
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /product="Myelin protein zero-like protein 1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95297.1)"
     misc_feature    317..664
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /note="Immunoglobulin (Ig)-like domain of Protein zero
                     (P0) and similar proteins; Region: Ig_P0-like; cd05715"
                     /db_xref="CDD:143192"
     misc_feature    order(317..319,323..325,359..361,383..385,389..391,
                     515..517,524..526,569..574)
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /note="fourfold interface; other site"
                     /db_xref="CDD:143192"
     misc_feature    326..664
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /note="Immunoglobulin V-set domain; Region: V-set;
                     pfam07686"
                     /db_xref="CDD:203725"
     misc_feature    689..751
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95297.1);
                     transmembrane region"
     misc_feature    800..802
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="dephosphorylation site; modified site"
                     /citation=[10]
                     /db_xref="HPRD:01470"
     misc_feature    818..820
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    824..826
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (O95297.1); phosphorylation site"
     misc_feature    824..826
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    830..832
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (O95297.1); phosphorylation site"
     misc_feature    830..832
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    857..859
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (O95297.1); phosphorylation site"
     misc_feature    863..865
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (O95297.1); phosphorylation site"
     misc_feature    869..871
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    917..934
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95297.1);
                     Region: ITIM motif 1"
     misc_feature    923..925
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="dephosphorylation site; modified site"
                     /citation=[7]
                     /citation=[8]
                     /db_xref="HPRD:01470"
     misc_feature    923..925
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphotyrosine; propagated from
                     UniProtKB/Swiss-Prot (O95297.1); phosphorylation site"
     misc_feature    923..925
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /citation=[7]
                     /citation=[8]
                     /db_xref="HPRD:01819"
     misc_feature    980..982
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (O95297.1); phosphorylation site"
     misc_feature    983..1000
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95297.1);
                     Region: ITIM motif 2"
     misc_feature    989..991
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="dephosphorylation site; modified site"
                     /citation=[7]
                     /citation=[8]
                     /db_xref="HPRD:01470"
     misc_feature    989..991
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphotyrosine; propagated from
                     UniProtKB/Swiss-Prot (O95297.1); phosphorylation site"
     misc_feature    989..991
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /citation=[7]
                     /citation=[8]
                     /db_xref="HPRD:01819"
     variation       242
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113319606"
     variation       243
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368926182"
     exon            294..460
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="alignment:Splign:1.39.8"
     variation       319
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200435022"
     variation       338
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369822857"
     variation       372
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375713174"
     variation       397
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150711804"
     variation       404
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146968580"
     variation       415
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143448673"
     variation       418
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201705663"
     variation       450
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369996563"
     exon            461..674
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="alignment:Splign:1.39.8"
     variation       465
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201193049"
     variation       484
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375159380"
     variation       504
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368816230"
     variation       586
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371291585"
     variation       615
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141242973"
     variation       619
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150774030"
     variation       649
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375912956"
     variation       665
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367767112"
     exon            675..807
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="alignment:Splign:1.39.8"
     variation       746
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375340075"
     variation       747
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368992613"
     variation       779
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373029251"
     variation       799
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200583957"
     exon            808..910
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="alignment:Splign:1.39.8"
     variation       817
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199586587"
     variation       830
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:372694435"
     variation       852
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150906954"
     variation       897
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201934009"
     exon            911..5010
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="alignment:Splign:1.39.8"
     variation       933
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:146099511"
     variation       943
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139028868"
     variation       947
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146869026"
     variation       964..965
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:34626910"
     STS             974..1130
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="SHGC-75878"
                     /db_xref="UniSTS:7599"
     variation       993
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375874838"
     variation       994
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200004895"
     variation       1002
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190661858"
     variation       1024
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377498586"
     variation       1147
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141592237"
     variation       1183
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150901710"
     variation       1198
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78809449"
     variation       1293
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182898542"
     variation       1294
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185441444"
     variation       1337
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190151302"
     variation       1462
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41270734"
     variation       1596
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182824572"
     STS             1623..1768
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="RH12295"
                     /db_xref="UniSTS:58576"
     variation       1700
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112509046"
     variation       1710
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:187389510"
     variation       1805
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:193160724"
     variation       1811
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138177732"
     variation       1813
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183755663"
     variation       1872
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73037892"
     variation       1877
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:114584283"
     variation       1891
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115952869"
     variation       1914
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:72697779"
     variation       1922
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149549702"
     variation       1934
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370896138"
     variation       1943
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:193135489"
     variation       1952
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147274411"
     variation       1971
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:34678493"
     variation       2048
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140780938"
     variation       2116
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:720612"
     variation       2127
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113574305"
     variation       2157
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147412044"
     variation       2175
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:183563193"
     variation       2190..2191
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:35089441"
     variation       2233
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12072200"
     variation       2280
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:186815046"
     variation       2291
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:7414295"
     variation       2361
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:191636295"
     variation       2374
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184020611"
     variation       2376
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:189800509"
     variation       2396
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182056523"
     variation       2409
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185413057"
     variation       2505
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:10125"
     variation       2517
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142735758"
     variation       2544
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114704696"
     variation       2547..2551
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace=""
                     /replace="aagat"
                     /db_xref="dbSNP:66529257"
     variation       2563
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76940524"
     variation       2577
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35215126"
     STS             2592..3427
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="MPZL1__7200"
                     /db_xref="UniSTS:466339"
     variation       2638
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3752606"
     variation       2694
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151009335"
     variation       2736
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140712114"
     variation       2755
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3088322"
     variation       2850
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143124803"
     variation       2852
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:12745388"
     variation       2987
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74388383"
     variation       2993
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:146700702"
     STS             3017..3091
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="D1S1803E"
                     /db_xref="UniSTS:150719"
     STS             3106..3243
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="WI-12092"
                     /db_xref="UniSTS:34243"
     STS             3107..3206
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="D1S1795E"
                     /db_xref="UniSTS:47740"
     variation       3130
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190565454"
     variation       3135
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:7605"
     STS             3217..3972
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="FLJ21047_2474"
                     /db_xref="UniSTS:463588"
     STS             3267..3368
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="RH36145"
                     /db_xref="UniSTS:64757"
     variation       3273
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11807657"
     variation       3374
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181999887"
     variation       3427
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:14212"
     variation       3458..3461
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace=""
                     /replace="agtt"
                     /db_xref="dbSNP:374021239"
     variation       3505
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61995896"
     variation       3592
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:140274317"
     variation       3605
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:8917"
     variation       3692
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:8623"
     variation       3706
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185284937"
     STS             3716..3829
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="A007A43"
                     /db_xref="UniSTS:35948"
     variation       3748
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145325991"
     variation       3756
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12316"
     variation       4019
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12071420"
     variation       4043
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189891170"
     variation       4050
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148979779"
     variation       4163
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:113581119"
     variation       4252
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148155475"
     variation       4279
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141847648"
     variation       4324
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368920044"
     variation       4376
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:10753763"
     variation       4423
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:76775177"
     variation       4460
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:371184482"
     variation       4489
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35065671"
     variation       4545
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:139012766"
     variation       4575
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181105938"
     variation       4585
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:10753764"
     variation       4601
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186660095"
     variation       4654
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191445959"
     variation       4660
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183602418"
     variation       4661
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:10800323"
     variation       4742
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188493549"
     variation       4827
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143146901"
     variation       4924
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192283907"
     variation       5007
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147481157"
ORIGIN      
agcgagggccggagtggggctgaggcttcggtgcagagctggagagccgcggctgggaccggagtggggagcgcggcgtggaggtgccacccggcgcgggtggcggagagatcagaagcctcttccccaagccgagccaacctcagcggggacccgggctcagggacgcggcggcggcggcggcgactgcagtggctggacgatggcagcgtccgccggagccggggcggtgattgcagccccagacagccggcgctggctgtggtcggtgctggcggcggcgcttgggctcttgacagctggagtatcagccttggaagtatatacgccaaaagaaatcttcgtggcaaatggtacacaagggaagctgacctgcaagttcaagtctactagtacgactggcgggttgacctcagtctcctggagcttccagccagagggggccgacactactgtgtcgtttttccactactcccaagggcaagtgtaccttgggaattatccaccatttaaagacagaatcagctgggctggagaccttgacaagaaagatgcatcaatcaacatagaaaatatgcagtttatacacaatggcacctatatctgtgatgtcaaaaaccctcctgacatcgttgtccagcctggacacattaggctctatgtcgtagaaaaagagaatttgcctgtgtttccagtttgggtagtggtgggcatagttactgctgtggtcctaggtctcactctgctcatcagcatgattctggctgtcctctatagaaggaaaaactctaaacgggattacactggctgcagtacatcagagagtttgtcaccagttaagcaggctcctcggaagtccccctccgacactgagggtcttgtaaagagtctgccttctggatctcaccagggcccagtcatatatgcacagttagaccactccggcggacatcacagtgacaagattaacaagtcagagtctgtggtgtatgcggatatccgaaagaattaagagaatacctagaacatatcctcagcaagaaacaaaaccaaactggactctcgtgcagaaaatgtagcccattaccacatgtagccttggagacccaggcaaggacaagtacacgtgtactcacagagggagagaaagatgtgtacaaaggatatgtataaatattctatttagtcatcctgatatgaggagccagtgttgcatgatgaaaagatggtatgattctacatatgtacccattgtcttgctgtttttgtactttcttttcaggtcatttacaattgggagatttcagaaacattcctttcaccatcatttagaaatggtttgccttaatggagacaatagcagatcctgtagtatttccagtagacatggccttttaatctaagggcttaagactgattagtcttagcatttactgtagttggaggatggagatgctatgatggaagcatacccagggtggcctttagcacagtatcagtaccatttatttgtctgccgcttttaaaaaatacccattggctatgccacttgaaaacaatttgagaagtttttttgaagtttttctcactaaaatatggggcaattgttagccttacatgttgtgtagacttactttaagtttgcacccttgaaatgtgtcatatcaatttctggattcataatagcaagattagcaaaggataaatgccgaaggtcacttcattctggacacagttggatcaatactgattaagtagaaaatccaagctttgcttgagaacttttgtaacgtggagagtaaaaagtatcggttttattctttgctgatgtcctttctgcttgaaataacagtcaccatacagctaaaggagaggagtttctttccttctaagtaggcagaaatggtatcattatgttgccgctctccaatctcccagagctcgctctctagagaatcaccttctttcgcttttttttttttttttgaggtagagtctcactatgttgcccagactagccttgaactcttgggctcaagtgattctccctcctcagcctcccgagtagctggaacgaactatagttgcaccactgcagctggcaagaatcaccttctttataaagcgtcagtcatgcttccagcaagaggcagcatcagtcatggctttataacagcttcatggtgcctcaaagactgttgaggttaatgagagcctagattagacagtttggctgtccttccctaaaacttgttttctcctattcactactccccaccgcacttaaaatctatgagtttttactttttactgggaatggaaagtgtggtgaagatcattcaacacttatgttgtcatttctcccattttctgaatttttttttaaatttccccccttttaaaattgttcgaaagcccacagttatggaaagaattactgtctagatggtctgcagaacgtgtttggggtgagtgggagtgaggggcaatgttactttttctccctgtagtttggagtccattatgagctgctgctttttcttctcatcttgtcatcttctggggatgtttgaaggctgagttccaacagaattcacaaagggaataaaacaggattgagattttgaggtgtgcacaaggtggtaagataaagggcatatgagcttcaaaactaatgctgttgcatacatgaagccttttgttttttgaggagctatttttgttattcttgtaacgctccaccttacatgccacatctgtgtgagtcaacagggatcaggtttggtcaccacacatgtctgaagctgggcagcgtctgctctgtgttctgtgtggaatggagaaaaaaacgcctgccctgctgccttccatgttcataggcccagcccaagagagtgacacacagtgctggccctgagacatttccacaaagtggtcaactctgccttgcatcctaaaactttttgggcatctattttgaaaactataggagcctttggaaggcctcttatgtttggaggggaagggtgttgagattgtcaccatccttcaagctgagactcctggtgagcctttgccaccatgaaaaccacatagctgaccagggctgtgcttgaggtacagaggacacacattgtagacaggcctgtgtcatgtttccttacagtcgttttttacagagaaaaggggcattgttttttcactgctttctcaacagttcctgtgaataaatgaaacatttcggagctccctgagagcaagagccttcacttcttcttgcggtgccgggaccatgtgttggtgaagctggtgctgtgggggccactcactcgaatgacacctggaggcctgttcctcccttaccactcccttccccagcccgacttcttggcctcctgcccaaccagacacctcaaactctgtcagtgccctggcattctggcagagaatcctcaccagttctcaccaaccttccccccaggcaagggcagctgccagcatggtgctctgccaggacaggtttccctgaaggaagctgctcacactgagatgagcctctcagggcaggacctcttcccaagccctgcacacccacccctgcagcccttttggctccccttttccctgtgcctcagcactcctttcctggttgcagataacgaactaaggttgcctaaagggcagatctgccctctccatgtcttcgtcctggcaaacagggtcgtcttaaaattatgcgctaattctgtatgggagcactcaaaaggcattacttagagattgaaatttcaaactatctctagtttttcaatggaaatatatcagctagggaaaaaccatcaagctcattattattttttgatcttcagttgtatttttgtgaatattttaatacatctttttcaatttctgaattgtgttgtgtgctcattttgaccagaatagaaaaagagatatgcctttcactcatatcattccagctacacctgccttcttttcttcaaaaatgccgtccgtgtgcctgcttctgggcctttgcacatgctgttccctgggcctgaagcatgccttctgccaatattcctgtggtttgctctctgacttcctttaagcctctgctcaaatgttacctcctcagggagaccttctgtgatatataaaagagcaagccccccaccccaccgcctcagccttcctggccccctcagttctgctctagttactctatttctctccctctttcccagtacacacttgtctgttctcccgcattagaacatagttaacaagagaccagaaccttgctgttttgttcactgctccgtctgcagtaaagggaacagcacctggcacttagctgctcaatacatgttacgtggatggatgagtaggtggaagcattcatccattcagcaacctacactgagaacaatcctgtgccaagcactgtgctaagcataaggaaacaaaacaagacaaagctcctcaaggagcttgccacagggtggaggtgacaggtgacatgaatggaagtaactagtagttaccaaatacttggtgtgagccaggcactttgcatttctttctctattatttctgtgagttaacagtaattgtactaatcttaatcccattgtttgaaagattatatggcttacccagggccacttagctaataaaggaacagagaagaggggctgggcctggggccgctgtttgatccacagccttgttcctaaccactatgccctgtggcctctcacaccaaaaggaagtaccaaactgcttccttactcaaataaatgtgctgaaatgcagttgcagttttctcccagtcccttaggagctggttagagagtcccttaggaacttgagagggtagtgtagtctaggtggtaggcacagatgtctgagagctttaacctcagtctggaagacaatgtggtgacttaatttgttgagaactatgttacaaataatgtgttactaataaaacattgaggcttcgcaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:9019 -> Molecular function: GO:0005198 [structural molecule activity] evidence: TAS
            GeneID:9019 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:9019 -> Biological process: GO:0007169 [transmembrane receptor protein tyrosine kinase signaling pathway] evidence: TAS
            GeneID:9019 -> Biological process: GO:0007267 [cell-cell signaling] evidence: TAS
            GeneID:9019 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.