2024-04-26 21:55:56, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_003480 2900 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens microfibrillar associated protein 5 (MFAP5), mRNA. ACCESSION NM_003480 VERSION NM_003480.2 GI:46359073 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2900) AUTHORS Turkyilmaz,E., Guner,H., Erdem,M., Erdem,A., Biri,A.A., Konac,E., Alp,E., Onen,H.I. and Menevse,S. TITLE NLF2 gene expression in the endometrium of patients with implantation failure after IVF treatment JOURNAL Gene 508 (1), 140-143 (2012) PUBMED 22885067 REMARK GeneRIF: Decreased MFAP5 gene expression in the endometrium of patients with implantation failure after in vitro ertilization treatment REFERENCE 2 (bases 1 to 2900) AUTHORS Rapko,S., Zhang,M., Richards,B., Hutto,E., Dethlefsen,S. and Duguay,S. TITLE Identification of the chondrocyte lineage using microfibril-associated glycoprotein-2, a novel marker that distinguishes chondrocytes from synovial cells JOURNAL Tissue Eng Part C Methods 16 (6), 1367-1375 (2010) PUBMED 20345228 REMARK GeneRIF: The MAGP2-based assay provided superior performance for the purpose of cell culture identification compared to assays using standard reference genes. REFERENCE 3 (bases 1 to 2900) AUTHORS Mok,S.C., Bonome,T., Vathipadiekal,V., Bell,A., Johnson,M.E., Wong,K.K., Park,D.C., Hao,K., Yip,D.K., Donninger,H., Ozbun,L., Samimi,G., Brady,J., Randonovich,M., Pise-Masison,C.A., Barrett,J.C., Wong,W.H., Welch,W.R., Berkowitz,R.S. and Birrer,M.J. TITLE A gene signature predictive for outcome in advanced ovarian cancer identifies a survival factor: microfibril-associated glycoprotein 2 JOURNAL Cancer Cell 16 (6), 521-532 (2009) PUBMED 19962670 REMARK GeneRIF: Independent evaluation confirmed the association of a prognostic gene microfibril-associated glycoprotein 2 (MAGP2) with poor prognosis in advanced ovarian cancer REFERENCE 4 (bases 1 to 2900) AUTHORS Albig,A.R., Becenti,D.J., Roy,T.G. and Schiemann,W.P. TITLE Microfibril-associate glycoprotein-2 (MAGP-2) promotes angiogenic cell sprouting by blocking notch signaling in endothelial cells JOURNAL Microvasc. Res. 76 (1), 7-14 (2008) PUBMED 18417156 REMARK GeneRIF: MAGP-2 promotes angiogenic cell spouting in vitro by antagonizing Notch signaling pathways in endothelial cells. REFERENCE 5 (bases 1 to 2900) AUTHORS Miyamoto,A., Lau,R., Hein,P.W., Shipley,J.M. and Weinmaster,G. TITLE Microfibrillar proteins MAGP-1 and MAGP-2 induce Notch1 extracellular domain dissociation and receptor activation JOURNAL J. Biol. Chem. 281 (15), 10089-10097 (2006) PUBMED 16492672 REMARK GeneRIF: microfibrillar proteins MAGP-1 and MAGP-2 can function outside of their role in elastic fibers to activate a cellular signaling pathway REFERENCE 6 (bases 1 to 2900) AUTHORS Imabayashi,H., Mori,T., Gojo,S., Kiyono,T., Sugiyama,T., Irie,R., Isogai,T., Hata,J., Toyama,Y. and Umezawa,A. TITLE Redifferentiation of dedifferentiated chondrocytes and chondrogenesis of human bone marrow stromal cells via chondrosphere formation with expression profiling by large-scale cDNA analysis JOURNAL Exp. Cell Res. 288 (1), 35-50 (2003) PUBMED 12878157 REFERENCE 7 (bases 1 to 2900) AUTHORS Penner,A.S., Rock,M.J., Kielty,C.M. and Shipley,J.M. TITLE Microfibril-associated glycoprotein-2 interacts with fibrillin-1 and fibrillin-2 suggesting a role for MAGP-2 in elastic fiber assembly JOURNAL J. Biol. Chem. 277 (38), 35044-35049 (2002) PUBMED 12122015 REFERENCE 8 (bases 1 to 2900) AUTHORS Hatzinikolas,G. and Gibson,M.A. TITLE The exon structure of the human MAGP-2 gene. Similarity with the MAGP-1 gene is confined to two exons encoding a cysteine-rich region JOURNAL J. Biol. Chem. 273 (45), 29309-29314 (1998) PUBMED 9792630 REFERENCE 9 (bases 1 to 2900) AUTHORS Gibson,M.A., Hatzinikolas,G., Kumaratilake,J.S., Sandberg,L.B., Nicholl,J.K., Sutherland,G.R. and Cleary,E.G. TITLE Further characterization of proteins associated with elastic fiber microfibrils including the molecular cloning of MAGP-2 (MP25) JOURNAL J. Biol. Chem. 271 (2), 1096-1103 (1996) PUBMED 8557636 REMARK Erratum:[J Biol Chem 1996 Mar 1;271(9):5288] COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK124368.1, AU280458.1, U37283.1, AL833019.1 and BM678444.1. On Apr 12, 2004 this sequence version replaced gi:4505088. Summary: This gene encodes a 25-kD microfibril-associated glycoprotein which is rich in serine and threonine residues. It lacks a hydrophobic carboxyl terminus and proline-, glutamine-, and tyrosine-rich regions, which are characteristics of a related 31-kDa microfibril-associated glycoprotein (MFAP2). The close similarity between these two proteins is confined to a central region of 60 aa where precise alignment of 7 cysteine residues occurs. The structural differences suggest that this encoded protein has some functions that are distinct from those of MFAP2. [provided by RefSeq, Jul 2008]. ##Evidence-Data-START## Transcript exon combination :: AK315807.1, BX398565.2 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-62 AK124368.1 48-109 63-74 AU280458.1 52-63 75-938 U37283.1 48-911 939-1935 AK124368.1 911-1907 1936-2836 AL833019.1 636-1536 2837-2900 BM678444.1 1-64 c FEATURES Location/Qualifiers source 1..2900 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="12" /map="12p13.1-p12.3" gene 1..2900 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /note="microfibrillar associated protein 5" /db_xref="GeneID:8076" /db_xref="HGNC:29673" /db_xref="HPRD:03063" /db_xref="MIM:601103" exon 1..211 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /inference="alignment:Splign:1.39.8" variation 147 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /replace="a" /replace="g" /db_xref="dbSNP:28372697" misc_feature 148..150 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /note="upstream in-frame stop codon" exon 212..271 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /inference="alignment:Splign:1.39.8" CDS 214..735 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /note="microfibril-associated glycoprotein-2; microfibrillar-associated protein 5; microfibril-associated glycoprotein 2; MAGP-2; MFAP-5" /codon_start=1 /product="microfibrillar-associated protein 5 precursor" /protein_id="NP_003471.1" /db_xref="GI:4505089" /db_xref="CCDS:CCDS8595.1" /db_xref="GeneID:8076" /db_xref="HGNC:29673" /db_xref="HPRD:03063" /db_xref="MIM:601103" /translation="
MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
" sig_peptide 214..297 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 217..627 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /note="Microfibril-associated glycoprotein (MAGP); Region: MAGP; pfam05507" /db_xref="CDD:114240" misc_feature 301..309 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q13361.1); Region: Cell attachment site (Potential)" variation 249 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /replace="a" /replace="t" /db_xref="dbSNP:1802863" exon 272..307 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /inference="alignment:Splign:1.39.8" exon 308..352 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /inference="alignment:Splign:1.39.8" exon 353..385 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /inference="alignment:Splign:1.39.8" exon 386..430 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /inference="alignment:Splign:1.39.8" exon 431..460 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /inference="alignment:Splign:1.39.8" exon 461..548 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /inference="alignment:Splign:1.39.8" exon 549..622 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /inference="alignment:Splign:1.39.8" exon 623..2882 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /inference="alignment:Splign:1.39.8" STS 793..893 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /standard_name="WI-17490" /db_xref="UniSTS:82486" variation 856 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /replace="c" /replace="t" /db_xref="dbSNP:14541" STS 1177..1398 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /standard_name="SHGC-58129" /db_xref="UniSTS:57233" STS 1429..1550 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /standard_name="RH99231" /db_xref="UniSTS:92005" variation 1922 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /replace="c" /replace="t" /db_xref="dbSNP:11544165" STS 2000..2088 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /standard_name="D8S2279" /db_xref="UniSTS:473907" STS 2050..2119 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /standard_name="D1S1423" /db_xref="UniSTS:149619" STS 2581..2797 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /standard_name="STS-W94200" /db_xref="UniSTS:6612" STS 2734..2809 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /standard_name="SHGC-36539" /db_xref="UniSTS:8198" polyA_signal 2819..2824 /gene="MFAP5" /gene_synonym="MAGP2; MP25" polyA_site 2836 /gene="MFAP5" /gene_synonym="MAGP2; MP25" polyA_signal 2860..2865 /gene="MFAP5" /gene_synonym="MAGP2; MP25" polyA_site 2882 /gene="MFAP5" /gene_synonym="MAGP2; MP25" /experiment="experimental evidence, no additional details recorded" ORIGIN
attccagcctcattgtaacacacattctacgcctagcctggctttcttgctctccctcatctcattgtttcagcggaggccaaatctgaagtcctttccagggagtggctctgttcatcttattcgccagccaaagtaggaacagcgtaagaggagagagacacattcagcagccaaaggactcggtggaaagagcagaacaccatagacaatatgtcgctcttgggacccaaggtgctgctgtttcttgctgcattcatcatcacctctgactggatacccctgggggtcaatagtcaacgaggagacgatgtgactcaagcgactccagaaacattcacagaagatcctaatctggtgaatgatcccgctacagatgaaacagttttggctgttttggctgatattgcaccttccacagatgacttggcctccctcagtgaaaaaaataccactgcagagtgctgggatgagaaatttacctgcacaaggctctactctgtgcatcggccggttaaacaatgcattcatcagttatgcttcaccagtttacgacgtatgtacatcgtcaacaaggagatctgctctcgtcttgtctgtaaggaacacgaagctatgaaagatgagctttgccgtcagatggctggtctgccccctaggagactccgtcgctccaattacttccgacttcctccctgtgaaaatgtggatttgcagagacccaatggtctgtgatcattgaaaaagaggaaagaagaaaaaatgtatgggtgagaggaaggaggatctccttcttctccaaccattgacagctaacccttagacagtatttcttaaaccaatccttttgcaatgtccagcttttacccctactctctactttttcacccaaactgataacatttatctcattttctagcacttaaaatacaaagtctatattattgcataattttgctgcttctcaatatcatagacacagtgaatagatgatgactatatggcttatatacaaacattctatgtacaatttcaagggagactaaactttaggctaataatctttactattgaatctgtctgatatagatcttagggttgaagaagctatctttgtctatttgggctaaccatagaatttcatttattttcctcacaatattttcctagaccaactccccatcattcacgtgttcctctttactcttactttaactattttgctggcttgcccgaaaatttgcctggcaagtcttccttataagacacatcatggtaagttttgtagtcctgtaagattctgcaacacagtcaagaattatacaatcctactagcaatatataaggacccaaaatgtcttctgctaagctcagaggctggggctaaagcatgaggactatgccagctatagaacttggactcataattcgctatccaatttttcatgcagttgtctagtcgggaagtaaggttggaaactaagtctcatttactgattcgtttatgggtagtaccgggatgaacccaccaccacaaagcaaattagacaacttaatgtgaaatcataccattggttgacgtttccttgagttgctacttcgttcatcttcacaacttaacaagtgcacggtcgaattattgtgcaagtggcttttggatatcctgattggggcctaagaagggcattcagacttgaattttaataggcagacagaaagtttgcctaatagttaatacgaaagagtgaaagaaacacaatattcagacaacccacattcttatcctggctctagcagtaaccacgtagccttggataagccattttccttcattaggtcctggtttaatttcctcatctttaaaatgagaaggttaaatttatcttagtactgctgggcgcagtggctcatgcctgtaatctgagcactttgggaagctgaggcgggtggatcacttgaggtcagaaatttgagacgagcctggccaacatggtgaaaccccatctctactaaaaatacaaaaattagctgggcgtggtggcacgtgcctgtaatcccagctactcgggaggctgaggcaggagaatcaattgaacctgggaggcagaggttgcagtgagccgagatggcgccattgcactccagcctgggtgacaaaagcaaaagtccatcttaagaaatatatatatatattatatatattcttagttctaagatttcctttaattctatgattctctggatttaaatgcattattcatatttcttgaagcttagatacagtctaattcatagcaaccatatctgctttatcctaggtgagggtagcagtccacaatggaatagaagaaaatcccattataacaaatgacaaattatatatcatgaatccttctgtctgactaactcaataactttctataaaagccaatggaattcaaataggagctaggagacaacaagttatatatgacagtggaggttgtattccttttatattgctgagaaaactagttaaatgatcagattcttgctgttaagaaacaatttcgtttaatgggatctgtacaactgattttaaaaaaatgctacaaaaagccccaaagcatataatctctactccttacagtctctagaattaaatgtactcatttagacaacatattaaatgcatattttagccactttagagaaacctcataggcacagagtttccaagattaattttaagaatatcttcacgaacttgaccctcctactccacattgcaacatttccatcagacagcatttcaattccagtattatgtatattgcaaattaaacattttaaaatatttttttccaatttatttctcaaaataaaatgtcttttgttctggtaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:8076 -> Molecular function: GO:0005201 [extracellular matrix structural constituent] evidence: TAS GeneID:8076 -> Biological process: GO:0030198 [extracellular matrix organization] evidence: TAS GeneID:8076 -> Biological process: GO:0043206 [extracellular fibril organization] evidence: IEA GeneID:8076 -> Cellular component: GO:0001527 [microfibril] evidence: IEA GeneID:8076 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.