2024-04-26 00:24:24, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002623 1383 bp mRNA linear PRI 16-JUN-2013 DEFINITION Homo sapiens prefoldin subunit 4 (PFDN4), mRNA. ACCESSION NM_002623 VERSION NM_002623.3 GI:54792079 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1383) AUTHORS Hirota,T., Takahashi,A., Kubo,M., Tsunoda,T., Tomita,K., Sakashita,M., Yamada,T., Fujieda,S., Tanaka,S., Doi,S., Miyatake,A., Enomoto,T., Nishiyama,C., Nakano,N., Maeda,K., Okumura,K., Ogawa,H., Ikeda,S., Noguchi,E., Sakamoto,T., Hizawa,N., Ebe,K., Saeki,H., Sasaki,T., Ebihara,T., Amagai,M., Takeuchi,S., Furue,M., Nakamura,Y. and Tamari,M. TITLE Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population JOURNAL Nat. Genet. 44 (11), 1222-1226 (2012) PUBMED 23042114 REFERENCE 2 (bases 1 to 1383) AUTHORS Comuzzie,A.G., Cole,S.A., Laston,S.L., Voruganti,V.S., Haack,K., Gibbs,R.A. and Butte,N.F. TITLE Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population JOURNAL PLoS ONE 7 (12), E51954 (2012) PUBMED 23251661 REFERENCE 3 (bases 1 to 1383) AUTHORS Miyoshi,N., Ishii,H., Mimori,K., Nishida,N., Tokuoka,M., Akita,H., Sekimoto,M., Doki,Y. and Mori,M. TITLE Abnormal expression of PFDN4 in colorectal cancer: a novel marker for prognosis JOURNAL Ann. Surg. Oncol. 17 (11), 3030-3036 (2010) PUBMED 20552408 REMARK GeneRIF: PFDN4 inhibition resulted in an increase in cell growth and invasiveness in colorectal cancer cell lines. REFERENCE 4 (bases 1 to 1383) AUTHORS Djouder,N., Metzler,S.C., Schmidt,A., Wirbelauer,C., Gstaiger,M., Aebersold,R., Hess,D. and Krek,W. TITLE S6K1-mediated disassembly of mitochondrial URI/PP1gamma complexes activates a negative feedback program that counters S6K1 survival signaling JOURNAL Mol. Cell 28 (1), 28-40 (2007) PUBMED 17936702 REFERENCE 5 (bases 1 to 1383) AUTHORS Simons,C.T., Staes,A., Rommelaere,H., Ampe,C., Lewis,S.A. and Cowan,N.J. TITLE Selective contribution of eukaryotic prefoldin subunits to actin and tubulin binding JOURNAL J. Biol. Chem. 279 (6), 4196-4203 (2004) PUBMED 14634002 REFERENCE 6 (bases 1 to 1383) AUTHORS Deloukas,P., Matthews,L.H., Ashurst,J., Burton,J., Gilbert,J.G., Jones,M., Stavrides,G., Almeida,J.P., Babbage,A.K., Bagguley,C.L., Bailey,J., Barlow,K.F., Bates,K.N., Beard,L.M., Beare,D.M., Beasley,O.P., Bird,C.P., Blakey,S.E., Bridgeman,A.M., Brown,A.J., Buck,D., Burrill,W., Butler,A.P., Carder,C., Carter,N.P., Chapman,J.C., Clamp,M., Clark,G., Clark,L.N., Clark,S.Y., Clee,C.M., Clegg,S., Cobley,V.E., Collier,R.E., Connor,R., Corby,N.R., Coulson,A., Coville,G.J., Deadman,R., Dhami,P., Dunn,M., Ellington,A.G., Frankland,J.A., Fraser,A., French,L., Garner,P., Grafham,D.V., Griffiths,C., Griffiths,M.N., Gwilliam,R., Hall,R.E., Hammond,S., Harley,J.L., Heath,P.D., Ho,S., Holden,J.L., Howden,P.J., Huckle,E., Hunt,A.R., Hunt,S.E., Jekosch,K., Johnson,C.M., Johnson,D., Kay,M.P., Kimberley,A.M., King,A., Knights,A., Laird,G.K., Lawlor,S., Lehvaslaiho,M.H., Leversha,M., Lloyd,C., Lloyd,D.M., Lovell,J.D., Marsh,V.L., Martin,S.L., McConnachie,L.J., McLay,K., McMurray,A.A., Milne,S., Mistry,D., Moore,M.J., Mullikin,J.C., Nickerson,T., Oliver,K., Parker,A., Patel,R., Pearce,T.A., Peck,A.I., Phillimore,B.J., Prathalingam,S.R., Plumb,R.W., Ramsay,H., Rice,C.M., Ross,M.T., Scott,C.E., Sehra,H.K., Shownkeen,R., Sims,S., Skuce,C.D., Smith,M.L., Soderlund,C., Steward,C.A., Sulston,J.E., Swann,M., Sycamore,N., Taylor,R., Tee,L., Thomas,D.W., Thorpe,A., Tracey,A., Tromans,A.C., Vaudin,M., Wall,M., Wallis,J.M., Whitehead,S.L., Whittaker,P., Willey,D.L., Williams,L., Williams,S.A., Wilming,L., Wray,P.W., Hubbard,T., Durbin,R.M., Bentley,D.R., Beck,S. and Rogers,J. TITLE The DNA sequence and comparative analysis of human chromosome 20 JOURNAL Nature 414 (6866), 865-871 (2001) PUBMED 11780052 REFERENCE 7 (bases 1 to 1383) AUTHORS Cowan,N.J. and Lewis,S.A. TITLE A chaperone with a hydrophilic surface JOURNAL Nat. Struct. Biol. 6 (11), 990-991 (1999) PUBMED 10542082 REFERENCE 8 (bases 1 to 1383) AUTHORS Hansen,W.J., Cowan,N.J. and Welch,W.J. TITLE Prefoldin-nascent chain complexes in the folding of cytoskeletal proteins JOURNAL J. Cell Biol. 145 (2), 265-277 (1999) PUBMED 10209023 REFERENCE 9 (bases 1 to 1383) AUTHORS Vainberg,I.E., Lewis,S.A., Rommelaere,H., Ampe,C., Vandekerckhove,J., Klein,H.L. and Cowan,N.J. TITLE Prefoldin, a chaperone that delivers unfolded proteins to cytosolic chaperonin JOURNAL Cell 93 (5), 863-873 (1998) PUBMED 9630229 REFERENCE 10 (bases 1 to 1383) AUTHORS Iijima,M., Kano,Y., Nohno,T. and Namba,M. TITLE Cloning of cDNA with possible transcription factor activity at the G1-S phase transition in human fibroblast cell lines JOURNAL Acta Med. Okayama 50 (2), 73-77 (1996) PUBMED 8744932 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CN482830.1, BC010953.1, U41816.1 and AL133335.29. On Oct 28, 2004 this sequence version replaced gi:12408676. Summary: This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: U41816.1, BM806238.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-124 CN482830.1 1-124 125-590 BC010953.1 5-470 591-605 U41816.1 452-466 606-1329 AL133335.29 41883-42606 1330-1383 U41816.1 1188-1241 FEATURES Location/Qualifiers source 1..1383 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="20" /map="20q13.2" gene 1..1383 /gene="PFDN4" /gene_synonym="C1; PFD4" /note="prefoldin subunit 4" /db_xref="GeneID:5203" /db_xref="HGNC:8868" /db_xref="HPRD:05358" /db_xref="MIM:604898" exon 1..162 /gene="PFDN4" /gene_synonym="C1; PFD4" /inference="alignment:Splign:1.39.8" misc_feature 124..126 /gene="PFDN4" /gene_synonym="C1; PFD4" /note="upstream in-frame stop codon" CDS 139..543 /gene="PFDN4" /gene_synonym="C1; PFD4" /note="prefoldin 4; protein C-1" /codon_start=1 /product="prefoldin subunit 4" /protein_id="NP_002614.2" /db_xref="GI:12408677" /db_xref="CCDS:CCDS13445.1" /db_xref="GeneID:5203" /db_xref="HGNC:8868" /db_xref="HPRD:05358" /db_xref="MIM:604898" /translation="
MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES
" misc_feature 196..516 /gene="PFDN4" /gene_synonym="C1; PFD4" /note="Prefoldin subunit; Region: Prefoldin_2; pfam01920" /db_xref="CDD:202045" misc_feature 511..513 /gene="PFDN4" /gene_synonym="C1; PFD4" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (Q9NQP4.1); phosphorylation site" exon 163..270 /gene="PFDN4" /gene_synonym="C1; PFD4" /inference="alignment:Splign:1.39.8" variation 190 /gene="PFDN4" /gene_synonym="C1; PFD4" /replace="c" /replace="g" /db_xref="dbSNP:6127140" STS 207..389 /gene="PFDN4" /gene_synonym="C1; PFD4" /standard_name="RH47160" /db_xref="UniSTS:789" STS 207..333 /gene="PFDN4" /gene_synonym="C1; PFD4" /standard_name="RH47163" /db_xref="UniSTS:788" STS 220..377 /gene="PFDN4" /gene_synonym="C1; PFD4" /standard_name="SHGC-2608" /db_xref="UniSTS:34776" exon 271..411 /gene="PFDN4" /gene_synonym="C1; PFD4" /inference="alignment:Splign:1.39.8" variation 279 /gene="PFDN4" /gene_synonym="C1; PFD4" /replace="a" /replace="c" /db_xref="dbSNP:376961672" variation 319 /gene="PFDN4" /gene_synonym="C1; PFD4" /replace="c" /replace="g" /db_xref="dbSNP:148299643" variation 327 /gene="PFDN4" /gene_synonym="C1; PFD4" /replace="c" /replace="t" /db_xref="dbSNP:369214934" variation 387 /gene="PFDN4" /gene_synonym="C1; PFD4" /replace="a" /replace="g" /db_xref="dbSNP:76841395" exon 412..1346 /gene="PFDN4" /gene_synonym="C1; PFD4" /inference="alignment:Splign:1.39.8" variation 435 /gene="PFDN4" /gene_synonym="C1; PFD4" /replace="c" /replace="t" /db_xref="dbSNP:145690568" variation 436 /gene="PFDN4" /gene_synonym="C1; PFD4" /replace="a" /replace="g" /db_xref="dbSNP:368220174" variation 467 /gene="PFDN4" /gene_synonym="C1; PFD4" /replace="a" /replace="g" /db_xref="dbSNP:199901569" variation 539 /gene="PFDN4" /gene_synonym="C1; PFD4" /replace="a" /replace="g" /db_xref="dbSNP:115409787" polyA_signal 573..578 /gene="PFDN4" /gene_synonym="C1; PFD4" polyA_site 596 /gene="PFDN4" /gene_synonym="C1; PFD4" variation 726 /gene="PFDN4" /gene_synonym="C1; PFD4" /replace="c" /replace="t" /db_xref="dbSNP:143697055" polyA_signal 785..790 /gene="PFDN4" /gene_synonym="C1; PFD4" polyA_site 810 /gene="PFDN4" /gene_synonym="C1; PFD4" variation 878..880 /gene="PFDN4" /gene_synonym="C1; PFD4" /replace="" /replace="tgt" /db_xref="dbSNP:150624897" variation 928 /gene="PFDN4" /gene_synonym="C1; PFD4" /replace="c" /replace="t" /db_xref="dbSNP:6023044" variation 1167 /gene="PFDN4" /gene_synonym="C1; PFD4" /replace="a" /replace="g" /db_xref="dbSNP:377687060" variation 1210 /gene="PFDN4" /gene_synonym="C1; PFD4" /replace="c" /replace="t" /db_xref="dbSNP:371165467" polyA_signal 1324..1329 /gene="PFDN4" /gene_synonym="C1; PFD4" variation 1331 /gene="PFDN4" /gene_synonym="C1; PFD4" /replace="a" /replace="g" /db_xref="dbSNP:180795020" polyA_site 1346 /gene="PFDN4" /gene_synonym="C1; PFD4" ORIGIN
aaagtccaagaggacggaatgtggagacagtgttgtatttttgcggggagttctaggccgaccgggagcgagagaacgctcgggggcgaagcgcgccattgcggccctccccgccgcctgcggtagtccagtcccaagatggcggccaccatgaagaaggcggctgcagaagatgtcaatgttactttcgaagatcaacaaaagataaacaaatttgcacggaatacaagtagaatcacagagctgaaggaagaaatagaagtaaaaaagaaacaactccaaaacctagaagatgcttgtgatgacatcatgcttgcagatgatgattgcttaatgataccttatcaaattggtgatgtcttcattagccattctcaagaagaaacgcaagaaatgttagaagaagcaaagaaaaatttgcaagaagaaattgacgccttagaatccagagtggaatcaattcagcgagtgttagcagatttgaaagttcagttgtatgcaaaattcgggagcaacataaaccttgaagctgatgaaagttaaacattttataatactttttttatttgtttaataaacttgaatattgtttaaaatgataattttccttcttcaaatgacatggaaagcaaaactttcttttttaaaaattttcatttatttaatggaaacttgcccattttcacatgtctgcttatttattttatatttttaaaagaagacagtattcacctatgtattttgcataacgattatatcaagtctaggggcttcatgtcatgttattaaaatcagttaagcaatcttttatgtttctatattatttagaatatttgttgttgcaattttcacataagaaaatttaacagttgtgtcatgttgtttctgtctgattttaattgctgtctaatgacggggaaagcacgatgaaaagatgtacaatcctgcatccttgcttatttcacaactaaagctttgtcatagacttcaaaatatatatgtatatattttatttaaatatatgttacatattatatttaaacatacatatttaacattttttacatatctatcaatatcagagatttgggtaaaagaatgggtaatgtttaaacatgtggaggcatgtggagctttatacaaacagggcagaaccacagaagaacgttttagaaaccaagagatgtgcagaaagaaatgtttagtgttttttcgttttaaattttagattttattttagtgctttgtaattaattggggtttatattgataaagatgtggaagttaaacagctatgtatgtaaaagtaaggcttatttcttaaataaaggatgcatttcttcccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:5203 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:5203 -> Molecular function: GO:0051082 [unfolded protein binding] evidence: IEA GeneID:5203 -> Molecular function: GO:0051087 [chaperone binding] evidence: TAS GeneID:5203 -> Biological process: GO:0006457 [protein folding] evidence: TAS GeneID:5203 -> Biological process: GO:0044267 [cellular protein metabolic process] evidence: TAS GeneID:5203 -> Biological process: GO:0051084 ['de novo' posttranslational protein folding] evidence: TAS GeneID:5203 -> Cellular component: GO:0005634 [nucleus] evidence: IDA GeneID:5203 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA GeneID:5203 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA GeneID:5203 -> Cellular component: GO:0005829 [cytosol] evidence: NAS GeneID:5203 -> Cellular component: GO:0016272 [prefoldin complex] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.