GGRNA Home | Help | Advanced search

2024-04-20 17:34:36, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001937               1749 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens dermatopontin (DPT), mRNA.
ACCESSION   NM_001937
VERSION     NM_001937.4  GI:299758400
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1749)
  AUTHORS   Yamatoji,M., Kasamatsu,A., Kouzu,Y., Koike,H., Sakamoto,Y.,
            Ogawara,K., Shiiba,M., Tanzawa,H. and Uzawa,K.
  TITLE     Dermatopontin: a potential predictor for metastasis of human oral
            cancer
  JOURNAL   Int. J. Cancer 130 (12), 2903-2911 (2012)
   PUBMED   21796630
  REMARK    GeneRIF: data provided strong evidence that downregulation of DPT
            is a characteristic event in human oral squamous cell carcinoma and
            that DPT was correlated with cellular adhesion and invasiveness.
REFERENCE   2  (bases 1 to 1749)
  AUTHORS   Kato,A., Okamoto,O., Ishikawa,K., Sumiyoshi,H., Matsuo,N.,
            Yoshioka,H., Nomizu,M., Shimada,T. and Fujiwara,S.
  TITLE     Dermatopontin interacts with fibronectin, promotes fibronectin
            fibril formation, and enhances cell adhesion
  JOURNAL   J. Biol. Chem. 286 (17), 14861-14869 (2011)
   PUBMED   21398523
  REMARK    GeneRIF: DPT has an accelerating role in fibroblast cell adhesion
            to the provisional matrix in the initial stage of wound healing.
REFERENCE   3  (bases 1 to 1749)
  AUTHORS   Ehret,G.B., O'Connor,A.A., Weder,A., Cooper,R.S. and Chakravarti,A.
  TITLE     Follow-up of a major linkage peak on chromosome 1 reveals
            suggestive QTLs associated with essential hypertension: GenNet
            study
  JOURNAL   Eur. J. Hum. Genet. 17 (12), 1650-1657 (2009)
   PUBMED   19536175
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   4  (bases 1 to 1749)
  AUTHORS   Li,X., Feng,P., Ou,J., Luo,Z., Dai,P., Wei,D. and Zhang,C.
  TITLE     Dermatopontin is expressed in human liver and is downregulated in
            hepatocellular carcinoma
  JOURNAL   Biochemistry Mosc. 74 (9), 979-985 (2009)
   PUBMED   19916908
  REMARK    GeneRIF: suggests that dermatopontin can play various roles in
            different tissues and might be a molecule related to carcinogenesis
            and the progression of HCC via possible interaction with TGF-beta1
            and other potential mechanisms
REFERENCE   5  (bases 1 to 1749)
  AUTHORS   Cheung,C.L., Chan,B.Y., Chan,V., Ikegawa,S., Kou,I., Ngai,H.,
            Smith,D., Luk,K.D., Huang,Q.Y., Mori,S., Sham,P.C. and Kung,A.W.
  TITLE     Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible
            genetic association with bone mineral density variation
  JOURNAL   Hum. Mol. Genet. 18 (4), 679-687 (2009)
   PUBMED   19064610
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   6  (bases 1 to 1749)
  AUTHORS   Pochampally,R.R., Ylostalo,J., Penfornis,P., Matz,R.R., Smith,J.R.
            and Prockop,D.J.
  TITLE     Histamine receptor H1 and dermatopontin: new downstream targets of
            the vitamin D receptor
  JOURNAL   J. Bone Miner. Res. 22 (9), 1338-1349 (2007)
   PUBMED   17547532
  REMARK    GeneRIF: roles of dermatopontin and histamine receptor H1 genes as
            downstream targets for the VDR were confirmed by gel
            electromotility shift and chromatin immunoprecipitation assays that
            showed the presence of VDR complex binding sequences
REFERENCE   7  (bases 1 to 1749)
  AUTHORS   Kuroda,K., Okamoto,O. and Shinkai,H.
  TITLE     Dermatopontin expression is decreased in hypertrophic scar and
            systemic sclerosis skin fibroblasts and is regulated by
            transforming growth factor-beta1, interleukin-4, and matrix
            collagen
  JOURNAL   J. Invest. Dermatol. 112 (5), 706-710 (1999)
   PUBMED   10233760
REFERENCE   8  (bases 1 to 1749)
  AUTHORS   Okamoto,O., Fujiwara,S., Abe,M. and Sato,Y.
  TITLE     Dermatopontin interacts with transforming growth factor beta and
            enhances its biological activity
  JOURNAL   Biochem. J. 337 (PT 3), 537-541 (1999)
   PUBMED   9895299
REFERENCE   9  (bases 1 to 1749)
  AUTHORS   Forbes,E.G., Cronshaw,A.D., MacBeath,J.R. and Hulmes,D.J.
  TITLE     Tyrosine-rich acidic matrix protein (TRAMP) is a tyrosine-sulphated
            and widely distributed protein of the extracellular matrix
  JOURNAL   FEBS Lett. 351 (3), 433-436 (1994)
   PUBMED   8082810
REFERENCE   10 (bases 1 to 1749)
  AUTHORS   Superti-Furga,A., Rocchi,M., Schafer,B.W. and Gitzelmann,R.
  TITLE     Complementary DNA sequence and chromosomal mapping of a human
            proteoglycan-binding cell-adhesion protein (dermatopontin)
  JOURNAL   Genomics 17 (2), 463-467 (1993)
   PUBMED   8104875
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BP257325.1, BC033736.1 and AI699890.1.
            On Jun 26, 2010 this sequence version replaced gi:32307171.
            
            Summary: Dermatopontin is an extracellular matrix protein with
            possible functions in cell-matrix interactions and matrix assembly.
            The protein is found in various tissues and many of its tyrosine
            residues are sulphated. Dermatopontin is postulated to modify the
            behavior of TGF-beta through interaction with decorin. [provided by
            RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CD685387.1, BC033736.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025083 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-564               BP257325.1         1-564
            565-1717            BC033736.1         551-1703
            1718-1749           AI699890.1         1-32                c
FEATURES             Location/Qualifiers
     source          1..1749
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q12-q23"
     gene            1..1749
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /note="dermatopontin"
                     /db_xref="GeneID:1805"
                     /db_xref="HGNC:3011"
                     /db_xref="HPRD:00510"
                     /db_xref="MIM:125597"
     exon            1..335
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /inference="alignment:Splign:1.39.8"
     CDS             31..636
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /note="tyrosine-rich acidic matrix protein"
                     /codon_start=1
                     /product="dermatopontin precursor"
                     /protein_id="NP_001928.2"
                     /db_xref="GI:32307172"
                     /db_xref="CCDS:CCDS1275.1"
                     /db_xref="GeneID:1805"
                     /db_xref="HGNC:3011"
                     /db_xref="HPRD:00510"
                     /db_xref="MIM:125597"
                     /translation="
MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV
"
     sig_peptide     31..84
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     mat_peptide     85..633
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /product="Dermatopontin"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q07507.2)"
     misc_feature    85..87
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="(By similarity); propagated from
                     UniProtKB/Swiss-Prot (Q07507.2); other site"
     misc_feature    106..588
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q07507.2);
                     Region: 2 X 53-55 AA tandem repeats"
     misc_feature    238..588
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q07507.2);
                     Region: 3 X 6 AA repeats of D-R-[EQ]-W-[NQK]-[FY]"
     variation       145
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:998688"
     variation       270
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1052591"
     variation       307
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:998689"
     exon            336..461
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /inference="alignment:Splign:1.39.8"
     variation       385
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:11551958"
     variation       434
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:14395"
     exon            462..569
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /inference="alignment:Splign:1.39.8"
     variation       470
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11551959"
     exon            570..1728
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /inference="alignment:Splign:1.39.8"
     STS             588..786
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /standard_name="RH36563"
                     /db_xref="UniSTS:31366"
     STS             1487..1614
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /standard_name="RH103231"
                     /db_xref="UniSTS:97563"
     STS             1496..1668
                     /gene="DPT"
                     /gene_synonym="TRAMP"
                     /standard_name="SHGC-75872"
                     /db_xref="UniSTS:80307"
ORIGIN      
gtgacattgtttgccaaaatcccaggcagcatggacctcagtcttctctgggtacttctgcccctagtcaccatggcctggggccagtatggcgattatggatacccataccagcagtatcatgactacagcgatgatgggtgggtgaatttgaaccggcaaggcttcagctaccagtgtccccaggggcaggtgatagtggccgtgaggagcatcttcagcaagaaggaaggttctgacagacaatggaactacgcctgcatgcccacgccacagagcctcggggaacccacggagtgctggtgggaggagatcaacagggctggcatggaatggtaccagacgtgctccaacaatgggctggtggcaggattccagagccgctacttcgagtcagtgctggatcgggagtggcagttttactgttgtcgctacagcaagaggtgcccatattcctgctggctaacaacagaatatccaggtcactatggtgaggaaatggacatgatttcctacaattatgattactatatccgaggagcaacaaccactttctctgcagtggaaagggatcgccagtggaagttcataatgtgccggatgactgaatacgactgtgaatttgcaaatgtttagatttgccacataccaaatctgggtgaaaggaaaggggccggggacaggagggtgtccacatatgttaacatcagttggatctcctatagaagtttctgctgctctctttccttctccctgagctggtaactgcaatgccaacttcctgggcctttctgactagtatcacacttctaataaaatccacaattaaaccatgtttctcacttttcacatgtttcatagcaactgctttatatgactgatgatggcttccttgcacaccacatatacagtgcgcatgcttacagccgggcttctggagcaccagctgcagcctggctactgctttttactgcagaatgaactgcaagttcagcatagtggaggggagaggcagaactggaggagaggtgcagtgaaggttctctacagctaagcctgtttgaatgatacgtaggttccccaccaaaagcaggctttctgccctgagggacatcttcccactcccctgctccacatgagccatgcatgcttagcaatccaagtgcagagctctttgctccaggagtgaggagactgggaggtgaaatggggaaatggaagggtttggaggcagagctgaaaacagggttggaaggatttcctgaattagaagacaaacgttagcatacccagtaaggaaaatgagtgcaggggccaggggaacccgtgaggatcactctcaaatgagattaaaaacaaggaagcagagaatggtcagagaatgggattcagattgggaacttgtggggatgagagtgaccaggttgaactgggaagtggaaaaaggagtttgagtcactggcacctagaagcctgcccacgattcctaggaaggctggcagacaccctggaaccctggggagctactggcaaactctcctggattgggcctgatttttttggtgggaaaggctgccctggggatcaactttccttctgtgtgtggctcaggagttcttctgcagagatggcgctatctttcctcctcctgtgatgtcctgctcccaaccatttgtactcttcattacaaaagaaataaaaatattaacgttcactatgctgaaaataaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:1805 -> Biological process: GO:0007155 [cell adhesion] evidence: IEA
            GeneID:1805 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IEA
            GeneID:1805 -> Biological process: GO:0030199 [collagen fibril organization] evidence: IEA
            GeneID:1805 -> Cellular component: GO:0005578 [proteinaceous extracellular matrix] evidence: IEA
            GeneID:1805 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA
            GeneID:1805 -> Cellular component: GO:0031012 [extracellular matrix] evidence: IDA
            GeneID:1805 -> Cellular component: GO:0031012 [extracellular matrix] evidence: ISS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.