GGRNA Home | Help | Advanced search

2024-04-27 12:01:18, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001425                850 bp    mRNA    linear   PRI 21-APR-2013
DEFINITION  Homo sapiens epithelial membrane protein 3 (EMP3), mRNA.
ACCESSION   NM_001425
VERSION     NM_001425.2  GI:168693626
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 850)
  AUTHORS   Pasini,A., Iorio,P., Bianchi,E., Cerasoli,S., Cremonini,A.M.,
            Faedi,M., Guarnieri,C., Guiducci,G., Riccioni,L., Molinari,C.,
            Rengucci,C., Calistri,D. and Giordano,E.
  TITLE     LOH 19q indicates shorter disease progression-free interval in
            low-grade oligodendrogliomas with EMP3 methylation
  JOURNAL   Oncol. Rep. 28 (6), 2271-2277 (2012)
   PUBMED   22992787
  REMARK    GeneRIF: LOH 19q determines the complete loss of EMP3 function, as
            the conserved allele is frequently hypermethylated, and this may
            represent the molecular basis of the higher risk of relapse in this
            subgroup of grade II oligodendroglioma patients.
REFERENCE   2  (bases 1 to 850)
  AUTHORS   Jiang,Z., Zhou,W., Li,X.G., Jiang,Y.Q., Wang,L., Wang,D.H.,
            Wang,X.Y. and Li,X.E.
  TITLE     [The methylation analysis of EMP3 and PCDH-gamma-A11 gene in human
            glioma]
  JOURNAL   Zhonghua Wai Ke Za Zhi 48 (4), 300-304 (2010)
   PUBMED   20388442
  REMARK    GeneRIF: The promoter methylation and mRNA expressions of EMP3 and
            PCDH-gamma-A11 are closely related with the malignant development
            of glioma.
REFERENCE   3  (bases 1 to 850)
  AUTHORS   Fumoto,S., Hiyama,K., Tanimoto,K., Noguchi,T., Hihara,J.,
            Hiyama,E., Noguchi,T. and Nishiyama,M.
  TITLE     EMP3 as a tumor suppressor gene for esophageal squamous cell
            carcinoma
  JOURNAL   Cancer Lett. 274 (1), 25-32 (2009)
   PUBMED   18823699
  REMARK    GeneRIF: Loss of EMP3 is associated with esophageal squamous cell
            carcinoma.
REFERENCE   4  (bases 1 to 850)
  AUTHORS   Zhou,W., Jiang,Z., Li,X., Xu,F., Liu,Y., Wen,P., Kong,L., Hou,M.
            and Yu,J.
  TITLE     EMP3 overexpression in primary breast carcinomas is not associated
            with epigenetic aberrations
  JOURNAL   J. Korean Med. Sci. 24 (1), 97-103 (2009)
   PUBMED   19270820
  REMARK    GeneRIF: Epithelial membrane protein 3 overexpression in breast
            carcinomas was significantly related to histological grade III ,
            lymph node metastasis , and strong Her-2 expression.
REFERENCE   5  (bases 1 to 850)
  AUTHORS   Kunitz,A., Wolter,M., van den Boom,J., Felsberg,J., Tews,B.,
            Hahn,M., Benner,A., Sabel,M., Lichter,P., Reifenberger,G., von
            Deimling,A. and Hartmann,C.
  TITLE     DNA hypermethylation and aberrant expression of the EMP3 gene at
            19q13.3 in Human Gliomas
  JOURNAL   Brain Pathol. 17 (4), 363-370 (2007)
   PUBMED   17610521
  REMARK    GeneRIF: Oligodendroglial and astrocytic gliomas show EMP3
            hypermethylation and aberrant expression.  Primary and secondary
            glioblastomas have distinct genetic profiles and also differ in
            their epigenetic aberrations.
REFERENCE   6  (bases 1 to 850)
  AUTHORS   Liehr,T., Kuhlenbaumer,G., Wulf,P., Taylor,V., Suter,U., Van
            Broeckhoven,C., Lupski,J.R., Claussen,U. and Rautenstrauss,B.
  TITLE     Regional localization of the human epithelial membrane protein
            genes 1, 2, and 3 (EMP1, EMP2, EMP3) to 12p12.3, 16p13.2, and
            19q13.3
  JOURNAL   Genomics 58 (1), 106-108 (1999)
   PUBMED   10331954
REFERENCE   7  (bases 1 to 850)
  AUTHORS   Bolin,L.M., McNeil,T., Lucian,L.A., DeVaux,B., Franz-Bacon,K.,
            Gorman,D.M., Zurawski,S., Murray,R. and McClanahan,T.K.
  TITLE     HNMP-1: a novel hematopoietic and neural membrane protein
            differentially regulated in neural development and injury
  JOURNAL   J. Neurosci. 17 (14), 5493-5502 (1997)
   PUBMED   9204931
REFERENCE   8  (bases 1 to 850)
  AUTHORS   Ben-Porath,I. and Benvenisty,N.
  TITLE     Characterization of a tumor-associated gene, a member of a novel
            family of genes encoding membrane glycoproteins
  JOURNAL   Gene 183 (1-2), 69-75 (1996)
   PUBMED   8996089
REFERENCE   9  (bases 1 to 850)
  AUTHORS   Taylor,V. and Suter,U.
  TITLE     Epithelial membrane protein-2 and epithelial membrane protein-3:
            two novel members of the peripheral myelin protein 22 gene family
  JOURNAL   Gene 175 (1-2), 115-120 (1996)
   PUBMED   8917086
REFERENCE   10 (bases 1 to 850)
  AUTHORS   Lobsiger,C.S., Magyar,J.P., Taylor,V., Wulf,P., Welcher,A.A.,
            Program,A.E. and Suter,U.
  TITLE     Identification and characterization of a cDNA and the structural
            gene encoding the mouse epithelial membrane protein-1
  JOURNAL   Genomics 36 (3), 379-387 (1996)
   PUBMED   8884260
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL541088.3 and BC009718.1.
            On Feb 23, 2008 this sequence version replaced gi:4503562.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AL541088.3, BQ072922.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-748               AL541088.3         1-748
            749-850             BC009718.1         556-657
FEATURES             Location/Qualifiers
     source          1..850
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19q13.3"
     gene            1..850
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /note="epithelial membrane protein 3"
                     /db_xref="GeneID:2014"
                     /db_xref="HGNC:3335"
                     /db_xref="HPRD:18514"
                     /db_xref="MIM:602335"
     exon            1..239
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /inference="alignment:Splign:1.39.8"
     variation       73
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185841956"
     variation       197
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:80096621"
     misc_feature    219..221
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /note="upstream in-frame stop codon"
     variation       229
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:73587206"
     exon            240..332
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /inference="alignment:Splign:1.39.8"
     variation       244
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:61764024"
     CDS             255..746
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /note="EMP-3; HNMP-1; hematopoietic neural membrane
                     protein 1"
                     /codon_start=1
                     /product="epithelial membrane protein 3"
                     /protein_id="NP_001416.1"
                     /db_xref="GI:4503563"
                     /db_xref="CCDS:CCDS12715.1"
                     /db_xref="GeneID:2014"
                     /db_xref="HGNC:3335"
                     /db_xref="HPRD:18514"
                     /db_xref="MIM:602335"
                     /translation="
MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
"
     misc_feature    264..326
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P54852.1);
                     transmembrane region"
     misc_feature    318..722
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; pfam00822"
                     /db_xref="CDD:109862"
     misc_feature    450..512
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P54852.1);
                     transmembrane region"
     misc_feature    552..614
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P54852.1);
                     transmembrane region"
     misc_feature    669..731
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P54852.1);
                     transmembrane region"
     variation       257
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146324824"
     variation       290
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373974189"
     exon            333..435
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /inference="alignment:Splign:1.39.8"
     variation       352
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146091933"
     variation       377
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201392469"
     variation       378
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370992861"
     variation       386
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139549534"
     variation       422
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149302468"
     exon            436..576
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /inference="alignment:Splign:1.39.8"
     variation       449
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202209148"
     variation       476
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199699923"
     variation       487
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370028365"
     variation       505
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112486260"
     variation       528
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202222961"
     variation       532
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182097678"
     variation       542
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044391"
     variation       545
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044395"
     variation       555
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372202129"
     variation       574
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144587503"
     exon            577..829
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /inference="alignment:Splign:1.39.8"
     STS             579..746
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /standard_name="RH71237"
                     /db_xref="UniSTS:90100"
     variation       605
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044421"
     variation       614
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17850542"
     variation       617
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78590775"
     STS             621..725
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /standard_name="RH44868"
                     /db_xref="UniSTS:46144"
     variation       627
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4893"
     variation       663
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145315471"
     variation       669
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:373817758"
     variation       680
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:12610644"
     variation       695
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377482803"
     variation       729
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11671673"
     variation       739
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147560109"
     variation       747
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11671746"
     variation       749
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199576440"
     variation       753
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201861420"
     variation       762
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369650682"
     variation       770
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:12610655"
     variation       771
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200562056"
     variation       773
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61764025"
     variation       819
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:8355"
     variation       825
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11665"
     variation       829
                     /gene="EMP3"
                     /gene_synonym="YMP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3180511"
ORIGIN      
cgggagcaagagagaaggaggcccagacagtgagggcaggagggagagaagagacgcagaaggagagcgagcgagagagaaagggttctggattggaggggagagcaagggagggaggaaggcggtgagagaggcgggggcctcgggagggtgaaaggagggaggagaagggcggggcacggaggcccgagcgagggacaagactccgactccagctctgacttttttcgcggctctcggcttccactgcagccatgtcactcctcttgctggtggtctcagcccttcacatcctcattcttatactgcttttcgtggccactttggacaagtcctggtggactctccctgggaaagagtccctgaatctctggtacgactgcacgtggaacaacgacaccaaaacatgggcctgcagtaatgtcagcgagaatggctggctgaaggcggtgcaggtcctcatggtgctctccctcattctctgctgtctctccttcatcctgttcatgttccagctctacaccatgcgacgaggaggtctcttctatgccaccggcctctgccagctttgcaccagcgtggcggtgtttactggcgccttgatctatgccattcacgccgaggagatcctggagaagcacccgcgagggggcagcttcggatactgcttcgccctggcctgggtggccttccccctcgccctggtcagcggcatcatctacatccacctacggaagcgggagtgagcgccccgcctcgctcggctgcccccgccccttcccggcccccctcgccgcgcgtcctccaaaaaataaaaccttaaccgcggaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:2014 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: TAS
            GeneID:2014 -> Biological process: GO:0016049 [cell growth] evidence: IEA
            GeneID:2014 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.