2024-04-20 19:06:16, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001257158 6270 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens centrosomal protein 41kDa (CEP41), transcript variant 2, mRNA. ACCESSION NM_001257158 VERSION NM_001257158.1 GI:380692318 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 6270) AUTHORS Lee,J.E., Silhavy,J.L., Zaki,M.S., Schroth,J., Bielas,S.L., Marsh,S.E., Olvera,J., Brancati,F., Iannicelli,M., Ikegami,K., Schlossman,A.M., Merriman,B., Attie-Bitach,T., Logan,C.V., Glass,I.A., Cluckey,A., Louie,C.M., Lee,J.H., Raynes,H.R., Rapin,I., Castroviejo,I.P., Setou,M., Barbot,C., Boltshauser,E., Nelson,S.F., Hildebrandt,F., Johnson,C.A., Doherty,D.A., Valente,E.M. and Gleeson,J.G. TITLE CEP41 is mutated in Joubert syndrome and is required for tubulin glutamylation at the cilium JOURNAL Nat. Genet. 44 (2), 193-199 (2012) PUBMED 22246503 REMARK GeneRIF: The data identified CEP41 mutations as a cause of Joubert syndrome and implicated tubulin post-translational modification in the pathogenesis of human ciliary dysfunction. Publication Status: Online-Only REFERENCE 2 (bases 1 to 6270) AUTHORS Schneider,E., Mayer,S., El Hajj,N., Jensen,L.R., Kuss,A.W., Zischler,H., Kondova,I., Bontrop,R.E., Navarro,B., Fuchs,E., Zechner,U. and Haaf,T. TITLE Methylation and expression analyses of the 7q autism susceptibility locus genes MEST, COPG2, and TSGA14 in human and anthropoid primate cortices JOURNAL Cytogenet. Genome Res. 136 (4), 278-287 (2012) PUBMED 22456293 REMARK GeneRIF: In cortices, the MEST promoter was hemimethylated, as expected for a differentially methylated imprinting control region, whereas the COPG2 and TSGA14 promoters were completely demethylated, typical for transcriptionally active non-imprinted genes. REFERENCE 3 (bases 1 to 6270) AUTHORS Korvatska,O., Estes,A., Munson,J., Dawson,G., Bekris,L.M., Kohen,R., Yu,C.E., Schellenberg,G.D. and Raskind,W.H. TITLE Mutations in the TSGA14 gene in families with autism spectrum disorders JOURNAL Am. J. Med. Genet. B Neuropsychiatr. Genet. 156B (3), 303-311 (2011) PUBMED 21438139 REMARK GeneRIF: Three rare potentially pathogenic variants were identified in the TSGA14 gene, which encodes a centrosomal protein. REFERENCE 4 (bases 1 to 6270) AUTHORS Wang,A.G., Yoon,S.Y., Oh,J.H., Jeon,Y.J., Kim,M., Kim,J.M., Byun,S.S., Yang,J.O., Kim,J.H., Kim,D.G., Yeom,Y.I., Yoo,H.S., Kim,Y.S. and Kim,N.S. TITLE Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags JOURNAL Biochem. Biophys. Res. Commun. 345 (3), 1022-1032 (2006) PUBMED 16712791 REFERENCE 5 (bases 1 to 6270) AUTHORS Andersen,J.S., Wilkinson,C.J., Mayor,T., Mortensen,P., Nigg,E.A. and Mann,M. TITLE Proteomic characterization of the human centrosome by protein correlation profiling JOURNAL Nature 426 (6966), 570-574 (2003) PUBMED 14654843 REFERENCE 6 (bases 1 to 6270) AUTHORS Yamada,T., Kayashima,T., Yamasaki,K., Ohta,T., Yoshiura,Ki., Matsumoto,N., Fujimoto,S., Niikawa,N. and Kishino,T. TITLE The gene TSGA14, adjacent to the imprinted gene MEST, escapes genomic imprinting JOURNAL Gene 288 (1-2), 57-63 (2002) PUBMED 12034494 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CB155730.1, DB069500.1, BC018789.1 and AC007938.1. Summary: This gene encodes a centrosomal and microtubule-binding protein which is predicted to have two coiled-coil domains and a rhodanese domain. In human retinal pigment epithelial cells the protein localized to centrioles and cilia. Mutations in this gene have been associated with Joubert Syndrome 15; an autosomal recessive ciliopathy and neurological disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2012]. Transcript Variant: This variant (2) lacks an in-frame exon in the 3' coding region, compared to variant 1, which results in a shorter isoform (2), compared to isoform 1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: BC018789.1, BM479225.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025088 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-239 CB155730.1 28-266 240-240 DB069500.1 242-242 241-2504 BC018789.1 23-2286 2505-6270 AC007938.1 49189-52954 c FEATURES Location/Qualifiers source 1..6270 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="7" /map="7q32" gene 1..6270 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /note="centrosomal protein 41kDa" /db_xref="GeneID:95681" /db_xref="HGNC:12370" /db_xref="MIM:610523" exon 1..277 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /inference="alignment:Splign:1.39.8" variation 158 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /replace="c" /replace="t" /db_xref="dbSNP:28403587" misc_feature 194..196 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /note="upstream in-frame stop codon" CDS 245..1150 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /note="isoform 2 is encoded by transcript variant 2; centrosomal protein 41 kDa; centrosomal protein of 41 kDa; testis specific protein A14; testis-specific gene A14 protein; testis specific, 14" /codon_start=1 /product="centrosomal protein of 41 kDa isoform 2" /protein_id="NP_001244087.1" /db_xref="GI:380692319" /db_xref="CCDS:CCDS59079.1" /db_xref="GeneID:95681" /db_xref="HGNC:12370" /db_xref="MIM:610523" /translation="
MSLRRHIGNPEYLMKRIPQNPRYQHIKSRLDTGNSMTKYTEKLEEIKKNYRYKKDELFKRLKVTTFAQLIIQVASLSDQTLEVTAEEIQRLEDNDSAASDPDAETTARTNGKGNPGEQSPSPEQFINNAGAGDSSRSTLQSVISGVGELDLDKGPVKKAEPHTKDKPYPDCPFLLLDVRDRDSYQQCHIVGAYSYPIATLSRTMNPYSNDILEYKNAHGKIIILYDDDERLASQAATTMCERGFENLFMLSGGRLNQANSSGRESKVPGARSAQNLPGGGPASHSNPRSLSSGHLQGKPWK
" misc_feature 752..1003 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /note="Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins...; Region: RHOD; cd00158" /db_xref="CDD:29073" misc_feature 920..922 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /note="active site residue [active]" /db_xref="CDD:29073" exon 278..341 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /inference="alignment:Splign:1.39.8" variation 286 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /replace="a" /replace="g" /db_xref="dbSNP:11556189" exon 342..389 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /inference="alignment:Splign:1.39.8" exon 390..451 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /inference="alignment:Splign:1.39.8" exon 452..521 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /inference="alignment:Splign:1.39.8" exon 522..666 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /inference="alignment:Splign:1.39.8" exon 667..818 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /inference="alignment:Splign:1.39.8" exon 819..886 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /inference="alignment:Splign:1.39.8" exon 887..1001 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /inference="alignment:Splign:1.39.8" exon 1002..6270 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /inference="alignment:Splign:1.39.8" STS 2297..2427 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /standard_name="D7S2396" /db_xref="UniSTS:77851" STS 2320..2455 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /standard_name="D7S2107E" /db_xref="UniSTS:12990" STS 2366..2491 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /standard_name="SHGC-30423" /db_xref="UniSTS:61854" variation 2508 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /replace="" /replace="a" /db_xref="dbSNP:71178582" STS 2772..3529 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /standard_name="TSGA14__5148" /db_xref="UniSTS:466534" STS 3220..3393 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /standard_name="RH92008" /db_xref="UniSTS:84067" polyA_signal 3487..3492 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" polyA_site 3507 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" variation 4145..4146 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /replace="" /replace="t" /db_xref="dbSNP:71311101" STS 5071..5130 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /standard_name="D7S1958" /db_xref="UniSTS:7728" STS 6114..6247 /gene="CEP41" /gene_synonym="JBTS15; TSGA14" /standard_name="WI-14634" /db_xref="UniSTS:69783" ORIGIN
agagaacaaaaggcctcgctagccggcgtcccgcgttgcccttggcaaccattgagcggcgtcttgcccttctgcgaccctgagatgagagagtaaacggggcccccattggccggccggggaagacgggccaatcggagaagagggtatagggaggcggctgaacaaggttgtgggggtaggaagctagggttagaggcaacccgtgaggctagaaccccgaacgtggtcggttggagaaaatatgtccctccggaggcacattgggaaccctgagtatctgatgaaaaggataccacagaacccaagataccagcatatcaaatcaagactggacactggtaacagtatgactaaatatactgagaagctcgaagagattaagaaaaattatagatacaaaaaagatgagcttttcaagagactaaaagttacaacttttgcccagctgatcatccaagttgcttccctctctgatcaaacactggaagtgacagctgaggagattcaaaggctggaagacaatgattctgcagcttcagaccctgatgctgaaaccactgccaggaccaatgggaaaggaaatccaggtgagcagtcgccgagccctgagcagttcataaacaacgcaggagcaggggactccagccgctcaactcttcagagtgtcatcagtggtgttggggaactggatctagacaaagggccagtgaagaaagcagagccccataccaaagacaaaccttatcctgactgccccttcctgctgctagatgtgcgtgatagagattcttaccagcagtgccacattgttggagcttacagttacccaattgcaactctgtctagaacaatgaacccttattcaaatgatattcttgaatataaaaatgcccatggcaagatcatcattctgtatgacgatgatgaaaggctggccagtcaggcggccaccaccatgtgcgagcgtggatttgaaaacctcttcatgctttccggaggccgactgaaccaagctaactcctccggaagagagtccaaggtgcctggtgcccgaagcgctcagaatctgccaggtggcggccccgccagccactcaaacccccgctccctcagcagtggtcacctgcaaggcaaaccctggaagtaaagactttgtctcacttaggcaaataaatgttcttcctcttttcagaacccctgagcatttcccaagttgggtcatttccagaaacttctgcagaggaaagaccatgacatatgtatgggataggcctcttccctgtccctgtctccagttcctctcccctcaggaggccacctcaggaaggattttgacaggtgaccataaaaaccagaggtgtgacaggctctagtctcctccctgttgtttacagcatatttaagtcttgtgaaactgtataggaaaaaagtatctacgtttttagtttttttgttttgtttttttttaataaggtccagcttgttgggtctctctgtgttgttttgtaaatacttcagtcacatctgcccgtgtgcctgtccctgccaccttttcattcactgttcttgacttcatgaaggcttctccgggcagtcttggtgtgagaagctgtttccaagggtgcagatgagccttaggttccagccgcctgcagaccccaccccagcaggctcactcagcaaggagctctctgcccagcatattgcaggccctgttttgagtatggaagccagtgcctgtgtactcactgaaattgaagatgaggaaagtagctgtacactcactgaatgctcccccttactagatatttcctggagccagaaaggtatgcatgtgggtgtcttcacaccggggaggagggcctctcatgggaaagccctggccaccacaccggcctgtgccccttgaagcccaccaaagcggccctcacttgtggtcagtatatcagttatgacgcccattgcccagcttcagtccatccatgttagatggacagaaattatggccagttgaaaataccagctttggttggacaactgtggacacacaaggtgaagaggactccgaagtcctttgtcagggctgacaacctcgtaagcccttgcttagaaatacagtattagtctaattgagtaattagtgcaatttcctgcttacttttcattctcatgactgaactgtgattaggaagttgtgattatagattctggttttggccggaattttgaatcagcattaattgaattgctaaatgactgacattcattccatttaattgggggaacaaaaggcctcaggtaaggatgaggaactctgaaatcagatggaaaagagcggtgttaatttttatggtctgtgatcgtagctgtgataagggactgaggaataaattgtgctctttgtcatggcaaccagcttctgaaaagcccactgaaaattgcctgtcctgctggtaactgctacggggtaagatttgccttaacagtactattttctcgccaccaaaaaaaaaaaaaaaaaaaaaaaaaaatgcaccacagtatttctagcatgggggctgtgtttgtatgagaaataaacgtaataaatatctcatagagacatatggaaaaataactttcagattcagcccagttctgttttagagtgtgtttattcttctctacttgatttccaaagtgcaacattttccgatgctttagaaatcaaacaaaccagggacattgttcagatgtcaagccatgcccaattttccacaagattcaagaatcttgtataaaattcagccaacgtacacatagctttaatgaggagcctgtcatgtttccccataaatttattgcctgagaacttagttcagcctttgctaatgccaaaatgctctggctttgtattttctttacagcatagatagaaaaatgcacatttttccacactcagctttcccctagcatggacaagattttcagccatttttgccacatatacatttttaaggaaaaaagatttttctctgtaagaaagttctggttatgctgttttaaaggtgacttgtcaggagttgagacttccctgccggattctattttgaaagtaaatggtcttccctccttgttccgattctgcgttcccatcgtcagacaactttggagtattagaaaccactgtatatatgtggaaagccaggtcagccagacctgttagaattggtgtgcactcacctgagagatctggcaggttggatatatttatgtgtatttctccacagtgcttgctttgccctgttggtaaggattttaaataaccatgctcaaaagagctgttctaatctgcgttttgcatgttaagtgttaatatcaaacattctttacgtgctcgaggtattgcttttaacattctactttgccagtttcttcattagattaattgacatgtattatttaaatgaccagtgatgctttgtgcaattatgaatgttgaagattaaagtacatagttactaatttgtcgtttgctattaatatgctgaaaactgccaacttctctcttcttttctgtcgagatgatttgggggagccacaggagactggtgtgatttttgctgcatctcctaggaaagcattttttaaaaaaaataaatgaatcaggaaatcagtccaattagggcagggggcctcagctctccagtcagaaagcctggatttcttttcctgctcaggctgggactgaagccaccttcaacaactggatcatggcttcctaccagcgtctcaggggttgactagctgcccttgtctggggcttgtgaaccctgagacagaaggtgcttcatcgatgtacaactacagcaccctgaacagcagtgatggccaaagtttaaataataccttaaatgctttaaaggggtttgtgtttaaggaagggagaaaagaaaaaaagaaaggaagggagaaagaagcaaggaaatgggaagaagggagggcagagagaagaaaagaagcagaaagcgagagagaaaggagaaagctacattacttatttgaaaacaaaaggaacaccctgggctgtaataatgtcaggctcaatctcttgaaaaagtatggaatgatttaaatggcctgcattcattttatcttttatctttttttttttttttaacctttagtggttagccaggaccagcacgatcatattgggcttggtataaatccgaatgaaaagagaccaaataacattcattagttgctcagggatttttcctgtggtgctatttaaattatacaaaaattcttaagactttaggctactcgaccaagaaaacagaacaaaacaaaaaatcgtgttttctctaattcccttgtggaatgtaagtgaaatcagagtcctaggctaggaagaaatacgtaggtaatttttcttgtgttggttttggtttctgtcatgttgtttattggctatagattctgtcttttatgttatctgacttttttagagcgaataattagtttctgtccacctggatttaaatccatgaccaccttcttgctctactctgaagataatcagtaagaacctttctttctccagttctaaaacgttctcagtgtctttaatgtgtgtttattttcttcccaattctttcaaagatttaactcccacgatacttttttttccccaggaaacaccgcaaatgtgtggaatataattcaccagtttaattatgtgagcatgttgagtacttacatgcaggtccattaatttttcactaacaattattttttcatgcaaaagcaataaataacattgtgcttccaaaatgttcagaatacatttgggtagtaatactttcctagatttacaataattattgaaattattattatgacatctttaaatggatacacaggtcagttacaacataaaaaatgtaatggtggaaatttgtcagccttgaattcaggcagaacaggattcggtgcatgattttatgtgttttcgaaacggtgtctgtcacattgtgatcccctgatggctcccctctctgttgctgatcctctttgttctgtacagaagcaaattctcacctgtgtaacatcctgaagcacctggtaaaatgtgaggcaaagagaggccacttctcaaatgctgtggacggatgggctgcatcttttaaaggatatcaatatgtcttcctgttgcaattattttgactataagctcccagagagtgaaaatcaccaaccctgtgacagtggcccttaataagtgttcatgaataaatgaattgaacctgtcaagattgaagtttggatgtgatgcccactgtggtggccactcagtgctagtctgtcattctggagacccagaaagctcgttatcttctgtcccccttgtgtatcctgcctttgtgggcgaggcattcaaaaccctgaggtttttagatctccctctacaggaagtacccagagagctgctgggggtgttattaccctgtctctgccaggcttaaagtatcctcccaaattcagcacgcaaaggtcacacaccacccccatcttaagagtaggttttctcttttgtttcaaatcttgaagatttccagaaaataataatactagccaatgtttgtggagagcttactttgctcctagattcttcattatatgttttgacccatttaatttccacaacagtctgatgaggcaggcacccccattttcagatgaggagactgaggttcgggtagaaattaagtgactcaggtttgccttcagtctctgaccaagggtttgaaaagccaggagccagcctgagaactgtggctccagagggtgttctttcagccactccgctctatgcttctcactctgggtgggcacaaccatgttctcctttggtgatgcctctaacttaccgtgaaaatgtacctttcccttcgctattggcttcccttccctcctagtcagccgagattcttttgaaaactttcctccgcttgcctgcacaaaaggcgatggaaattcaggaactgaaacatctgctctggggaatgcgtatttccacatttccaccgcctgtgtctgctgtcttatcttgaagacaggtgctccagggcttccgaggttattttgtctgttaatggacaccttgcaaagtaccacttaaggaatgagaattacaaacttttaattatattgtagggggaaaaaagtaggctgttttcctgataggtctagccattcattcagtaaaccatattgatatga
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:95681 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:95681 -> Biological process: GO:0000086 [G2/M transition of mitotic cell cycle] evidence: TAS GeneID:95681 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS GeneID:95681 -> Biological process: GO:0015031 [protein transport] evidence: IEA GeneID:95681 -> Biological process: GO:0018095 [protein polyglutamylation] evidence: ISS GeneID:95681 -> Biological process: GO:0042384 [cilium assembly] evidence: IMP GeneID:95681 -> Cellular component: GO:0005813 [centrosome] evidence: IDA GeneID:95681 -> Cellular component: GO:0005814 [centriole] evidence: IDA GeneID:95681 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:95681 -> Cellular component: GO:0036064 [cilium basal body] evidence: IDA GeneID:95681 -> Cellular component: GO:0072372 [primary cilium] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.