GGRNA Home | Help | Advanced search

2024-05-11 11:23:36, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001199515            3358 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens TGFB-induced factor homeobox 2 (TGIF2), transcript
            variant 4, mRNA.
ACCESSION   NM_001199515
VERSION     NM_001199515.1  GI:313747520
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3358)
  AUTHORS   Powers,S.E., Taniguchi,K., Yen,W., Melhuish,T.A., Shen,J.,
            Walsh,C.A., Sutherland,A.E. and Wotton,D.
  TITLE     Tgif1 and Tgif2 regulate Nodal signaling and are required for
            gastrulation
  JOURNAL   Development 137 (2), 249-259 (2010)
   PUBMED   20040491
  REMARK    GeneRIF: Shows that the homologous mouse Tgif2 gene is necessary
            for gastrulation.
REFERENCE   2  (bases 1 to 3358)
  AUTHORS   Suzuki,M. and Yoshino,I.
  TITLE     Identification of microRNAs caused by DNA methylation that induce
            metastasis
  JOURNAL   Future Oncol 4 (6), 775-777 (2008)
   PUBMED   19086843
REFERENCE   3  (bases 1 to 3358)
  AUTHORS   Lujambio,A., Calin,G.A., Villanueva,A., Ropero,S.,
            Sanchez-Cespedes,M., Blanco,D., Montuenga,L.M., Rossi,S.,
            Nicoloso,M.S., Faller,W.J., Gallagher,W.M., Eccles,S.A., Croce,C.M.
            and Esteller,M.
  TITLE     A microRNA DNA methylation signature for human cancer metastasis
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 105 (36), 13556-13561 (2008)
   PUBMED   18768788
REFERENCE   4  (bases 1 to 3358)
  AUTHORS   Spagnoli,F.M. and Brivanlou,A.H.
  TITLE     The Gata5 target, TGIF2, defines the pancreatic region by
            modulating BMP signals within the endoderm
  JOURNAL   Development 135 (3), 451-461 (2008)
   PUBMED   18094028
REFERENCE   5  (bases 1 to 3358)
  AUTHORS   Lips,E.H., van Eijk,R., de Graaf,E.J., Oosting,J., de Miranda,N.F.,
            Karsten,T., van de Velde,C.J., Eilers,P.H., Tollenaar,R.A., van
            Wezel,T. and Morreau,H.
  TITLE     Integrating chromosomal aberrations and gene expression profiles to
            dissect rectal tumorigenesis
  JOURNAL   BMC Cancer 8, 314 (2008)
   PUBMED   18959792
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 3358)
  AUTHORS   Melhuish,T.A. and Wotton,D.
  TITLE     The Tgif2 gene contains a retained intron within the coding
            sequence
  JOURNAL   BMC Mol. Biol. 7, 2 (2006)
   PUBMED   16436215
  REMARK    Publication Status: Online-Only
REFERENCE   7  (bases 1 to 3358)
  AUTHORS   Chung,C.M., Man,C., Jin,Y., Jin,C., Guan,X.Y., Wang,Q., Wan,T.S.,
            Cheung,A.L. and Tsao,S.W.
  TITLE     Amplification and overexpression of aurora kinase A (AURKA) in
            immortalized human ovarian epithelial (HOSE) cells
  JOURNAL   Mol. Carcinog. 43 (3), 165-174 (2005)
   PUBMED   15880741
REFERENCE   8  (bases 1 to 3358)
  AUTHORS   Watanabe,T., Imoto,I., Katahira,T., Hirasawa,A., Ishiwata,I.,
            Emi,M., Takayama,M., Sato,A. and Inazawa,J.
  TITLE     Differentially regulated genes as putative targets of
            amplifications at 20q in ovarian cancers
  JOURNAL   Jpn. J. Cancer Res. 93 (10), 1114-1122 (2002)
   PUBMED   12417041
REFERENCE   9  (bases 1 to 3358)
  AUTHORS   Melhuish,T.A., Gallo,C.M. and Wotton,D.
  TITLE     TGIF2 interacts with histone deacetylase 1 and represses
            transcription
  JOURNAL   J. Biol. Chem. 276 (34), 32109-32114 (2001)
   PUBMED   11427533
REFERENCE   10 (bases 1 to 3358)
  AUTHORS   Imoto,I., Pimkhaokham,A., Watanabe,T., Saito-Ohara,F., Soeda,E. and
            Inazawa,J.
  TITLE     Amplification and overexpression of TGIF2, a novel homeobox gene of
            the TALE superclass, in ovarian cancer cell lines
  JOURNAL   Biochem. Biophys. Res. Commun. 276 (1), 264-270 (2000)
   PUBMED   11006116
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BP353213.1, AK074802.1,
            BQ881960.1 and BI869422.1.
            
            Summary: The protein encoded by this gene is a DNA-binding homeobox
            protein and a transcriptional repressor, which appears to repress
            transcription by recruiting histone deacetylases to TGF
            beta-responsive genes. This gene is amplified and over-expressed in
            some ovarian cancers. Alternative splicing results in multiple
            transcript variants. A related pseudogene has been identified on
            chromosome 1. Read-through transcription also exists between this
            gene and the neighboring downstream C20orf24 (chromosome 20 open
            reading frame 24) gene. [provided by RefSeq, Dec 2010].
            
            Transcript Variant: This variant (4) differs in the 5' UTR compared
            to variant 1. All variants (1-4) encode the same protein.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BP353213.1, BP250158.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025085 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-343               BP353213.1         1-343
            344-2153            AK074802.1         381-2190
            2154-2187           BQ881960.1         191-224
            2188-3342           AK074802.1         2225-3379
            3343-3358           BI869422.1         426-441
FEATURES             Location/Qualifiers
     source          1..3358
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="20"
                     /map="20q11.23"
     gene            1..3358
                     /gene="TGIF2"
                     /note="TGFB-induced factor homeobox 2"
                     /db_xref="GeneID:60436"
                     /db_xref="HGNC:15764"
                     /db_xref="MIM:607294"
     exon            1..82
                     /gene="TGIF2"
                     /inference="alignment:Splign:1.39.8"
     exon            83..308
                     /gene="TGIF2"
                     /inference="alignment:Splign:1.39.8"
     variation       89
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374969064"
     variation       96
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368026783"
     misc_feature    102..104
                     /gene="TGIF2"
                     /note="upstream in-frame stop codon"
     CDS             117..830
                     /gene="TGIF2"
                     /note="TGF(beta)-induced transcription factor 2;
                     TGFB-induced factor 2 (TALE family homeobox);
                     transcription growth factor-beta-induced factor 2;
                     5'-TG-3' interacting factor 2; TGF-beta-induced
                     transcription factor 2"
                     /codon_start=1
                     /product="homeobox protein TGIF2"
                     /protein_id="NP_001186444.1"
                     /db_xref="GI:313747521"
                     /db_xref="CCDS:CCDS13278.1"
                     /db_xref="GeneID:60436"
                     /db_xref="HGNC:15764"
                     /db_xref="MIM:607294"
                     /translation="
MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ
"
     misc_feature    171..344
                     /gene="TGIF2"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(171..185,189..191,249..251,267..269,306..308,
                     312..317,324..329,333..341)
                     /gene="TGIF2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(177..179,186..188,315..317,324..329,336..338)
                     /gene="TGIF2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     misc_feature    423..827
                     /gene="TGIF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9GZN2.1);
                     Region: Repressive function"
     misc_feature    660..662
                     /gene="TGIF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine; propagated from
                     UniProtKB/Swiss-Prot (Q9GZN2.1); phosphorylation site"
     misc_feature    672..674
                     /gene="TGIF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine; propagated from
                     UniProtKB/Swiss-Prot (Q9GZN2.1); phosphorylation site"
     variation       143
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370918031"
     variation       152
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373991636"
     variation       163
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371719080"
     variation       203
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142209425"
     variation       231
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:147784268"
     variation       239
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6028205"
     variation       244
                     /gene="TGIF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:368202205"
     variation       247
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371990676"
     variation       266
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375356918"
     variation       292
                     /gene="TGIF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200411969"
     exon            309..3347
                     /gene="TGIF2"
                     /inference="alignment:Splign:1.39.8"
     variation       339
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375974955"
     variation       362
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369009714"
     variation       404
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139445684"
     variation       418
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373249992"
     variation       428
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375316891"
     variation       436
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199621279"
     variation       440
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200072791"
     variation       453
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151198555"
     variation       461..462
                     /gene="TGIF2"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:368920356"
     variation       514
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150460801"
     variation       534
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199730218"
     variation       559
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374216319"
     variation       595
                     /gene="TGIF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201632959"
     variation       701
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140990544"
     variation       722
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200959739"
     variation       767
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377713562"
     variation       779
                     /gene="TGIF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200681657"
     variation       842
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372115125"
     variation       849
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181179141"
     variation       852
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375919073"
     variation       882
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186881499"
     STS             895..1777
                     /gene="TGIF2"
                     /standard_name="TGIF2_2062"
                     /db_xref="UniSTS:281054"
     variation       1179
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6065106"
     variation       1256..1260
                     /gene="TGIF2"
                     /replace=""
                     /replace="aaaga"
                     /db_xref="dbSNP:377212348"
     variation       1290
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140265869"
     variation       1335..1338
                     /gene="TGIF2"
                     /replace=""
                     /replace="tccc"
                     /db_xref="dbSNP:370950422"
     variation       1337
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188876883"
     variation       1382
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6101370"
     variation       1403
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182005523"
     variation       1481
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6101371"
     variation       1525
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75484069"
     variation       1540
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:186240598"
     variation       1564..1565
                     /gene="TGIF2"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:200293257"
     variation       1572
                     /gene="TGIF2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:71901663"
     variation       1580..1581
                     /gene="TGIF2"
                     /replace=""
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:60964912"
     variation       1611
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74748470"
     variation       1750
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:4812359"
     STS             1760..1871
                     /gene="TGIF2"
                     /standard_name="A008R12"
                     /db_xref="UniSTS:4908"
     variation       1785
                     /gene="TGIF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:75858122"
     variation       1785
                     /gene="TGIF2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:113760296"
     variation       1809
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6101373"
     variation       1893
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376493075"
     variation       1910
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150382819"
     variation       1924
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138103023"
     variation       1957
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:71351028"
     variation       2154
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6016004"
     variation       2213
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:190701127"
     variation       2395
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143715787"
     variation       2412
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145811351"
     variation       2433
                     /gene="TGIF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1140732"
     variation       2493
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182600714"
     variation       2501
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:367638483"
     variation       2563
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138657186"
     variation       2645
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41276988"
     variation       2651
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371836516"
     variation       2678..2680
                     /gene="TGIF2"
                     /replace=""
                     /replace="ggat"
                     /db_xref="dbSNP:60435168"
     variation       2678..2679
                     /gene="TGIF2"
                     /replace=""
                     /replace="tgga"
                     /db_xref="dbSNP:112208120"
     variation       2678
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:151113715"
     variation       2679
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200316735"
     variation       2680
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201285664"
     variation       2704..2705
                     /gene="TGIF2"
                     /replace=""
                     /replace="at"
                     /db_xref="dbSNP:201834011"
     variation       2776
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185940389"
     variation       2795
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142756264"
     variation       2889
                     /gene="TGIF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:41276990"
     variation       2999
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:113228049"
     STS             3029..3280
                     /gene="TGIF2"
                     /standard_name="G07338"
                     /db_xref="UniSTS:83129"
     variation       3033
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1052112"
     STS             3076..3216
                     /gene="TGIF2"
                     /standard_name="RH77695"
                     /db_xref="UniSTS:16603"
     STS             3186..3265
                     /gene="TGIF2"
                     /standard_name="D20S561E"
                     /db_xref="UniSTS:64316"
     variation       3295
                     /gene="TGIF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:201975059"
     variation       3298..3304
                     /gene="TGIF2"
                     /replace=""
                     /replace="ttttgtc"
                     /db_xref="dbSNP:199875415"
     variation       3304
                     /gene="TGIF2"
                     /replace=""
                     /replace="ttttgtc"
                     /db_xref="dbSNP:111396010"
     polyA_signal    3313..3318
                     /gene="TGIF2"
     variation       3319
                     /gene="TGIF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:183220779"
     variation       3328
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:187660553"
     polyA_site      3345
                     /gene="TGIF2"
     polyA_site      3347
                     /gene="TGIF2"
ORIGIN      
cccgcgccccgaagagtcggccagccccgaactgccggagtaggggtgggaaccaaactttttcctgccccgggacagacacgtttacccaaggtccagcctagcccctaggcaccatgtcggacagtgatctaggtgaggacgaaggcctcctctccctggcgggcaaaaggaagcgcagggggaacctgcccaaggagtcggtgaagatcctccgggactggctgtacttgcaccgctacaacgcctacccctcagagcaggagaagctgagcctttctggacagaccaacctgtcagtgctgcaaatatgtaactggttcatcaatgcccggcggcggcttctcccagacatgcttcggaaggatggcaaagaccctaatcagtttaccatttcccgccgcgggggtaaggcctcagatgtggccctcccccgtggcagcagcccctcagtgctggctgtgtctgtcccagcccccaccaatgtgctctccctgtctgtgtgctccatgccgcttcactcaggccagggggaaaagccagcagcccctttcccacgtggggagctggagtctcccaagcccctggtgacccctggtagcacacttactctgctgaccagggctgaggctggaagccccacaggtggactcttcaacacgccaccacccacacccccagagcaggacaaagaggacttcagcagcttccagctgctggtggaggtggcgctacagagggctgctgagatggagcttcagaagcagcaggacccatcactcccattactgcacactcccatccctttagtctctgaaaatccccagtaggcatctgccaagaagggtgctgaaggctccagccagctgtcctgggtttccgttttggttccctttcatacagagggttttctatggatcactgccaaacattgggatcatctcctctgtccagaggtcttcaacaggaagatgccagctggcaccactgcactgtgatgggggccctctcctctgctgactctgccgtttctccaggcctccgctcagtgatgagaccaagagatcggagacaagcatggtgctgctgcttctgctgcttctccagaaaatccctgggacacctttgttccagcctggtttcctgggctgggctcaggaaagctgccaaattcagtcctatgttgggtccaagctgcccctgtgctgtttctgtcaagccaggtgtggacattccaagttcatatgcgtgaacaaaagaaaagaggaacccagtggatgtaacagaaccgactccagttgaatgtttagatttttgctaaactgttttctttttcccttttttgctgtggtttgcattcacggcagtagttagcccaggtgtggggaacgagagtgcactgcatgatagcgttctggtgagctgggaaggacccaccactgccactgaggattgttttggaagaaaggaatatttttatcttggggaccagctaagtctctgcagtagtgtgaaattccaaatggttgttttatcattggtttggtttaccaaaaaaaaggcagggaaaaaaaaaaaaaacaaccgtatgagcgcattggcttgtctgccgcaggcacagaagggtagaaagccacagcagggggcagtccagcagactctgactcaactttctaggcacctagcagagaaagataagatcaaaaggtgtttggtttttcttttaatttttattgtagtttttttgggtgggtgggggaagtaaactagactgaagcgatggattttttttttcttttttttctttagtgtttttccctttgttcttgaacacttttgccctgcagcctcagttttgaattcttttagcaacttggattagaggggcccatatgtcagaagctcccagcacctcctacttgggagaaaagtgagccatctgctggtcaggaagtcctccagagaggcagcttttcccacaatggtggcaggaaactttggggaaagcaggaatggtgtccactgctgcggaggaactgccttcagagaaggtggggctggaaaagggttagaagcctcctagctgggattgtctttgtttcacctttctttaaattagaattacagaagcccctgcccagtgaacagataacgattggtcttatgctcctccctttcccccattttttcttttgctgttttgttttttgttttttgtttgtttgtttgtttttttgagacagagtcatgctctgtcacccgggctggagtgcagtggtgcgatctcagctcactgtaacctccgcctcccgggttcaagcaattatttgcctcagcctcccgagtagctgggattataggcacccgccaccatgtctggcttttagtagagacggggtttcaccatcttggccaggctggtcttggaactcctgacctcgtgagccaccacgcccagcctcttttgctgtttcattgctgacagtgttcaacaatatgccccatctttatatatcctaagaaacactaatcctaggttattgctagccaaaatatttttgtcctgagtagtgtcactgggccaaaagatagatcaggacgacagcctttagttttcctgaaatcaccaggtcaggcacaaggagaaaaggttcctggatactgactaacttgggtgggtctagccaggagaaagacagtaacatgtgttctgtactttctgggaagatccctgaagccatcacagaggctccccaacttctgagtcgcccatctgttgctgtgggagtgtgaacggatcgctgaaggagagggagctttgctctctctaggtgggcaagtttcctgggctctctgtgttgcctccctctggcttcttcctcccgtgccctctccccgtgtgccccagggggatcagggatcctcaccctcctgaggcccagtggggaagaatgaacatggcttcatccaggttaactgatgctgccatttgcccagcctcttccatcccagccctgtcagtgagcccaggtctggtgcaactgctgcaggatgcctgtagtagggaactctggaagtgtattgggctgaggtgggattttccctccccacagtgcactgagcaatggagggtggtgagggagccatgctgctgaattctggttggcatttccccattatgtaaaatggggtgttgggtagggcagactctgcttgggtttggttgtaagataaacctggaggagaagcacagttgtcccattgaattatttgagcaaaaactactgtaaataacttttttgtcttttgtcaaataaaatttttttttgtttttttaagcagaaacaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:60436 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: NAS
            GeneID:60436 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:60436 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: IMP
            GeneID:60436 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: TAS
            GeneID:60436 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: TAS
            GeneID:60436 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: NAS
            GeneID:60436 -> Biological process: GO:0006367 [transcription initiation from RNA polymerase II promoter] evidence: TAS
            GeneID:60436 -> Biological process: GO:0007179 [transforming growth factor beta receptor signaling pathway] evidence: TAS
            GeneID:60436 -> Biological process: GO:0010467 [gene expression] evidence: TAS
            GeneID:60436 -> Cellular component: GO:0005634 [nucleus] evidence: TAS
            GeneID:60436 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.