GGRNA Home | Help | Advanced search

2024-04-26 17:57:11, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001199514            3456 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens TGFB-induced factor homeobox 2 (TGIF2), transcript
            variant 1, mRNA.
ACCESSION   NM_001199514
VERSION     NM_001199514.1  GI:313747518
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3456)
  AUTHORS   Powers,S.E., Taniguchi,K., Yen,W., Melhuish,T.A., Shen,J.,
            Walsh,C.A., Sutherland,A.E. and Wotton,D.
  TITLE     Tgif1 and Tgif2 regulate Nodal signaling and are required for
            gastrulation
  JOURNAL   Development 137 (2), 249-259 (2010)
   PUBMED   20040491
  REMARK    GeneRIF: Shows that the homologous mouse Tgif2 gene is necessary
            for gastrulation.
REFERENCE   2  (bases 1 to 3456)
  AUTHORS   Suzuki,M. and Yoshino,I.
  TITLE     Identification of microRNAs caused by DNA methylation that induce
            metastasis
  JOURNAL   Future Oncol 4 (6), 775-777 (2008)
   PUBMED   19086843
REFERENCE   3  (bases 1 to 3456)
  AUTHORS   Lujambio,A., Calin,G.A., Villanueva,A., Ropero,S.,
            Sanchez-Cespedes,M., Blanco,D., Montuenga,L.M., Rossi,S.,
            Nicoloso,M.S., Faller,W.J., Gallagher,W.M., Eccles,S.A., Croce,C.M.
            and Esteller,M.
  TITLE     A microRNA DNA methylation signature for human cancer metastasis
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 105 (36), 13556-13561 (2008)
   PUBMED   18768788
REFERENCE   4  (bases 1 to 3456)
  AUTHORS   Spagnoli,F.M. and Brivanlou,A.H.
  TITLE     The Gata5 target, TGIF2, defines the pancreatic region by
            modulating BMP signals within the endoderm
  JOURNAL   Development 135 (3), 451-461 (2008)
   PUBMED   18094028
REFERENCE   5  (bases 1 to 3456)
  AUTHORS   Lips,E.H., van Eijk,R., de Graaf,E.J., Oosting,J., de Miranda,N.F.,
            Karsten,T., van de Velde,C.J., Eilers,P.H., Tollenaar,R.A., van
            Wezel,T. and Morreau,H.
  TITLE     Integrating chromosomal aberrations and gene expression profiles to
            dissect rectal tumorigenesis
  JOURNAL   BMC Cancer 8, 314 (2008)
   PUBMED   18959792
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 3456)
  AUTHORS   Melhuish,T.A. and Wotton,D.
  TITLE     The Tgif2 gene contains a retained intron within the coding
            sequence
  JOURNAL   BMC Mol. Biol. 7, 2 (2006)
   PUBMED   16436215
  REMARK    Publication Status: Online-Only
REFERENCE   7  (bases 1 to 3456)
  AUTHORS   Chung,C.M., Man,C., Jin,Y., Jin,C., Guan,X.Y., Wang,Q., Wan,T.S.,
            Cheung,A.L. and Tsao,S.W.
  TITLE     Amplification and overexpression of aurora kinase A (AURKA) in
            immortalized human ovarian epithelial (HOSE) cells
  JOURNAL   Mol. Carcinog. 43 (3), 165-174 (2005)
   PUBMED   15880741
REFERENCE   8  (bases 1 to 3456)
  AUTHORS   Watanabe,T., Imoto,I., Katahira,T., Hirasawa,A., Ishiwata,I.,
            Emi,M., Takayama,M., Sato,A. and Inazawa,J.
  TITLE     Differentially regulated genes as putative targets of
            amplifications at 20q in ovarian cancers
  JOURNAL   Jpn. J. Cancer Res. 93 (10), 1114-1122 (2002)
   PUBMED   12417041
REFERENCE   9  (bases 1 to 3456)
  AUTHORS   Melhuish,T.A., Gallo,C.M. and Wotton,D.
  TITLE     TGIF2 interacts with histone deacetylase 1 and represses
            transcription
  JOURNAL   J. Biol. Chem. 276 (34), 32109-32114 (2001)
   PUBMED   11427533
REFERENCE   10 (bases 1 to 3456)
  AUTHORS   Imoto,I., Pimkhaokham,A., Watanabe,T., Saito-Ohara,F., Soeda,E. and
            Inazawa,J.
  TITLE     Amplification and overexpression of TGIF2, a novel homeobox gene of
            the TALE superclass, in ovarian cancer cell lines
  JOURNAL   Biochem. Biophys. Res. Commun. 276 (1), 264-270 (2000)
   PUBMED   11006116
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL705108.1, BG723865.1,
            AK074802.1, BQ881960.1 and BI869422.1.
            
            Summary: The protein encoded by this gene is a DNA-binding homeobox
            protein and a transcriptional repressor, which appears to repress
            transcription by recruiting histone deacetylases to TGF
            beta-responsive genes. This gene is amplified and over-expressed in
            some ovarian cancers. Alternative splicing results in multiple
            transcript variants. A related pseudogene has been identified on
            chromosome 1. Read-through transcription also exists between this
            gene and the neighboring downstream C20orf24 (chromosome 20 open
            reading frame 24) gene. [provided by RefSeq, Dec 2010].
            
            Transcript Variant: This variant (1) represents the longest
            transcript. All variants (1-4) encode the same protein.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BI907230.1, BG393335.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-15                AL705108.1         1-15
            16-21               BG723865.1         2-7
            22-543              BG723865.1         9-530
            544-2251            AK074802.1         483-2190
            2252-2285           BQ881960.1         191-224
            2286-3440           AK074802.1         2225-3379
            3441-3456           BI869422.1         426-441
FEATURES             Location/Qualifiers
     source          1..3456
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="20"
                     /map="20q11.23"
     gene            1..3456
                     /gene="TGIF2"
                     /note="TGFB-induced factor homeobox 2"
                     /db_xref="GeneID:60436"
                     /db_xref="HGNC:15764"
                     /db_xref="MIM:607294"
     exon            1..180
                     /gene="TGIF2"
                     /inference="alignment:Splign:1.39.8"
     variation       175
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:6101334"
     exon            181..406
                     /gene="TGIF2"
                     /inference="alignment:Splign:1.39.8"
     variation       187
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374969064"
     variation       194
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368026783"
     misc_feature    200..202
                     /gene="TGIF2"
                     /note="upstream in-frame stop codon"
     CDS             215..928
                     /gene="TGIF2"
                     /note="TGF(beta)-induced transcription factor 2;
                     TGFB-induced factor 2 (TALE family homeobox);
                     transcription growth factor-beta-induced factor 2;
                     5'-TG-3' interacting factor 2; TGF-beta-induced
                     transcription factor 2"
                     /codon_start=1
                     /product="homeobox protein TGIF2"
                     /protein_id="NP_001186443.1"
                     /db_xref="GI:313747519"
                     /db_xref="CCDS:CCDS13278.1"
                     /db_xref="GeneID:60436"
                     /db_xref="HGNC:15764"
                     /db_xref="MIM:607294"
                     /translation="
MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ
"
     misc_feature    269..442
                     /gene="TGIF2"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(269..283,287..289,347..349,365..367,404..406,
                     410..415,422..427,431..439)
                     /gene="TGIF2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(275..277,284..286,413..415,422..427,434..436)
                     /gene="TGIF2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     misc_feature    521..925
                     /gene="TGIF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9GZN2.1);
                     Region: Repressive function"
     misc_feature    758..760
                     /gene="TGIF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine; propagated from
                     UniProtKB/Swiss-Prot (Q9GZN2.1); phosphorylation site"
     misc_feature    770..772
                     /gene="TGIF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine; propagated from
                     UniProtKB/Swiss-Prot (Q9GZN2.1); phosphorylation site"
     variation       241
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370918031"
     variation       250
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373991636"
     variation       261
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371719080"
     variation       301
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142209425"
     variation       329
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:147784268"
     variation       337
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6028205"
     variation       342
                     /gene="TGIF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:368202205"
     variation       345
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371990676"
     variation       364
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375356918"
     variation       390
                     /gene="TGIF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200411969"
     exon            407..3445
                     /gene="TGIF2"
                     /inference="alignment:Splign:1.39.8"
     variation       437
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375974955"
     variation       460
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369009714"
     variation       502
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139445684"
     variation       516
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373249992"
     variation       526
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375316891"
     variation       534
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199621279"
     variation       538
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200072791"
     variation       551
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151198555"
     variation       559..560
                     /gene="TGIF2"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:368920356"
     variation       612
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150460801"
     variation       632
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199730218"
     variation       657
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374216319"
     variation       693
                     /gene="TGIF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201632959"
     variation       799
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140990544"
     variation       820
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200959739"
     variation       865
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377713562"
     variation       877
                     /gene="TGIF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200681657"
     variation       940
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372115125"
     variation       947
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181179141"
     variation       950
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375919073"
     variation       980
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186881499"
     STS             993..1875
                     /gene="TGIF2"
                     /standard_name="TGIF2_2062"
                     /db_xref="UniSTS:281054"
     variation       1277
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6065106"
     variation       1354..1358
                     /gene="TGIF2"
                     /replace=""
                     /replace="aaaga"
                     /db_xref="dbSNP:377212348"
     variation       1388
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140265869"
     variation       1433..1436
                     /gene="TGIF2"
                     /replace=""
                     /replace="tccc"
                     /db_xref="dbSNP:370950422"
     variation       1435
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188876883"
     variation       1480
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6101370"
     variation       1501
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182005523"
     variation       1579
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6101371"
     variation       1623
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75484069"
     variation       1638
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:186240598"
     variation       1662..1663
                     /gene="TGIF2"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:200293257"
     variation       1670
                     /gene="TGIF2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:71901663"
     variation       1678..1679
                     /gene="TGIF2"
                     /replace=""
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:60964912"
     variation       1709
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74748470"
     variation       1848
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:4812359"
     STS             1858..1969
                     /gene="TGIF2"
                     /standard_name="A008R12"
                     /db_xref="UniSTS:4908"
     variation       1883
                     /gene="TGIF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:75858122"
     variation       1883
                     /gene="TGIF2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:113760296"
     variation       1907
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6101373"
     variation       1991
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376493075"
     variation       2008
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150382819"
     variation       2022
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138103023"
     variation       2055
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:71351028"
     variation       2252
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6016004"
     variation       2311
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:190701127"
     variation       2493
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143715787"
     variation       2510
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145811351"
     variation       2531
                     /gene="TGIF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1140732"
     variation       2591
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182600714"
     variation       2599
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:367638483"
     variation       2661
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138657186"
     variation       2743
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41276988"
     variation       2749
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371836516"
     variation       2776..2778
                     /gene="TGIF2"
                     /replace=""
                     /replace="ggat"
                     /db_xref="dbSNP:60435168"
     variation       2776..2777
                     /gene="TGIF2"
                     /replace=""
                     /replace="tgga"
                     /db_xref="dbSNP:112208120"
     variation       2776
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:151113715"
     variation       2777
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200316735"
     variation       2778
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201285664"
     variation       2802..2803
                     /gene="TGIF2"
                     /replace=""
                     /replace="at"
                     /db_xref="dbSNP:201834011"
     variation       2874
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185940389"
     variation       2893
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142756264"
     variation       2987
                     /gene="TGIF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:41276990"
     variation       3097
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:113228049"
     STS             3127..3378
                     /gene="TGIF2"
                     /standard_name="G07338"
                     /db_xref="UniSTS:83129"
     variation       3131
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1052112"
     STS             3174..3314
                     /gene="TGIF2"
                     /standard_name="RH77695"
                     /db_xref="UniSTS:16603"
     STS             3284..3363
                     /gene="TGIF2"
                     /standard_name="D20S561E"
                     /db_xref="UniSTS:64316"
     variation       3393
                     /gene="TGIF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:201975059"
     variation       3396..3402
                     /gene="TGIF2"
                     /replace=""
                     /replace="ttttgtc"
                     /db_xref="dbSNP:199875415"
     variation       3402
                     /gene="TGIF2"
                     /replace=""
                     /replace="ttttgtc"
                     /db_xref="dbSNP:111396010"
     polyA_signal    3411..3416
                     /gene="TGIF2"
     variation       3417
                     /gene="TGIF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:183220779"
     variation       3426
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:187660553"
     polyA_site      3443
                     /gene="TGIF2"
     polyA_site      3445
                     /gene="TGIF2"
ORIGIN      
ccgacggcccgccccgcggggggtgggcgcagctcgtcgcgctccgcacaaagtttgttttctccctccgggcgggtgggggagggcgcagagggcgcggggggaggagaggggatctgacgtcaggccgcgaggtgctttccagccgcgagctgtcaggccgagtgtcaggccgggcaggtttacccaaggtccagcctagcccctaggcaccatgtcggacagtgatctaggtgaggacgaaggcctcctctccctggcgggcaaaaggaagcgcagggggaacctgcccaaggagtcggtgaagatcctccgggactggctgtacttgcaccgctacaacgcctacccctcagagcaggagaagctgagcctttctggacagaccaacctgtcagtgctgcaaatatgtaactggttcatcaatgcccggcggcggcttctcccagacatgcttcggaaggatggcaaagaccctaatcagtttaccatttcccgccgcgggggtaaggcctcagatgtggccctcccccgtggcagcagcccctcagtgctggctgtgtctgtcccagcccccaccaatgtgctctccctgtctgtgtgctccatgccgcttcactcaggccagggggaaaagccagcagcccctttcccacgtggggagctggagtctcccaagcccctggtgacccctggtagcacacttactctgctgaccagggctgaggctggaagccccacaggtggactcttcaacacgccaccacccacacccccagagcaggacaaagaggacttcagcagcttccagctgctggtggaggtggcgctacagagggctgctgagatggagcttcagaagcagcaggacccatcactcccattactgcacactcccatccctttagtctctgaaaatccccagtaggcatctgccaagaagggtgctgaaggctccagccagctgtcctgggtttccgttttggttccctttcatacagagggttttctatggatcactgccaaacattgggatcatctcctctgtccagaggtcttcaacaggaagatgccagctggcaccactgcactgtgatgggggccctctcctctgctgactctgccgtttctccaggcctccgctcagtgatgagaccaagagatcggagacaagcatggtgctgctgcttctgctgcttctccagaaaatccctgggacacctttgttccagcctggtttcctgggctgggctcaggaaagctgccaaattcagtcctatgttgggtccaagctgcccctgtgctgtttctgtcaagccaggtgtggacattccaagttcatatgcgtgaacaaaagaaaagaggaacccagtggatgtaacagaaccgactccagttgaatgtttagatttttgctaaactgttttctttttcccttttttgctgtggtttgcattcacggcagtagttagcccaggtgtggggaacgagagtgcactgcatgatagcgttctggtgagctgggaaggacccaccactgccactgaggattgttttggaagaaaggaatatttttatcttggggaccagctaagtctctgcagtagtgtgaaattccaaatggttgttttatcattggtttggtttaccaaaaaaaaggcagggaaaaaaaaaaaaaacaaccgtatgagcgcattggcttgtctgccgcaggcacagaagggtagaaagccacagcagggggcagtccagcagactctgactcaactttctaggcacctagcagagaaagataagatcaaaaggtgtttggtttttcttttaatttttattgtagtttttttgggtgggtgggggaagtaaactagactgaagcgatggattttttttttcttttttttctttagtgtttttccctttgttcttgaacacttttgccctgcagcctcagttttgaattcttttagcaacttggattagaggggcccatatgtcagaagctcccagcacctcctacttgggagaaaagtgagccatctgctggtcaggaagtcctccagagaggcagcttttcccacaatggtggcaggaaactttggggaaagcaggaatggtgtccactgctgcggaggaactgccttcagagaaggtggggctggaaaagggttagaagcctcctagctgggattgtctttgtttcacctttctttaaattagaattacagaagcccctgcccagtgaacagataacgattggtcttatgctcctccctttcccccattttttcttttgctgttttgttttttgttttttgtttgtttgtttgtttttttgagacagagtcatgctctgtcacccgggctggagtgcagtggtgcgatctcagctcactgtaacctccgcctcccgggttcaagcaattatttgcctcagcctcccgagtagctgggattataggcacccgccaccatgtctggcttttagtagagacggggtttcaccatcttggccaggctggtcttggaactcctgacctcgtgagccaccacgcccagcctcttttgctgtttcattgctgacagtgttcaacaatatgccccatctttatatatcctaagaaacactaatcctaggttattgctagccaaaatatttttgtcctgagtagtgtcactgggccaaaagatagatcaggacgacagcctttagttttcctgaaatcaccaggtcaggcacaaggagaaaaggttcctggatactgactaacttgggtgggtctagccaggagaaagacagtaacatgtgttctgtactttctgggaagatccctgaagccatcacagaggctccccaacttctgagtcgcccatctgttgctgtgggagtgtgaacggatcgctgaaggagagggagctttgctctctctaggtgggcaagtttcctgggctctctgtgttgcctccctctggcttcttcctcccgtgccctctccccgtgtgccccagggggatcagggatcctcaccctcctgaggcccagtggggaagaatgaacatggcttcatccaggttaactgatgctgccatttgcccagcctcttccatcccagccctgtcagtgagcccaggtctggtgcaactgctgcaggatgcctgtagtagggaactctggaagtgtattgggctgaggtgggattttccctccccacagtgcactgagcaatggagggtggtgagggagccatgctgctgaattctggttggcatttccccattatgtaaaatggggtgttgggtagggcagactctgcttgggtttggttgtaagataaacctggaggagaagcacagttgtcccattgaattatttgagcaaaaactactgtaaataacttttttgtcttttgtcaaataaaatttttttttgtttttttaagcagaaacaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:60436 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: NAS
            GeneID:60436 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:60436 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: IMP
            GeneID:60436 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: TAS
            GeneID:60436 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: TAS
            GeneID:60436 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: NAS
            GeneID:60436 -> Biological process: GO:0006367 [transcription initiation from RNA polymerase II promoter] evidence: TAS
            GeneID:60436 -> Biological process: GO:0007179 [transforming growth factor beta receptor signaling pathway] evidence: TAS
            GeneID:60436 -> Biological process: GO:0010467 [gene expression] evidence: TAS
            GeneID:60436 -> Cellular component: GO:0005634 [nucleus] evidence: TAS
            GeneID:60436 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.