Home |
Help |
Advanced search
2024-04-18 10:20:38, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001193333 1943 bp mRNA linear PRI 15-JUN-2013
DEFINITION Homo sapiens coronin, actin binding protein, 1A (CORO1A),
transcript variant 1, mRNA.
ACCESSION NM_001193333
VERSION NM_001193333.2 GI:306482594
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1943)
AUTHORS Oku,T., Nakano,M., Kaneko,Y., Ando,Y., Kenmotsu,H., Itoh,S.,
Tsuiji,M., Seyama,Y., Toyoshima,S. and Tsuji,T.
TITLE Constitutive turnover of phosphorylation at Thr-412 of human
p57/coronin-1 regulates the interaction with actin
JOURNAL J. Biol. Chem. 287 (51), 42910-42920 (2012)
PUBMED 23100250
REMARK GeneRIF: Constitutive turnover of phosphorylation at Thr-412 of
p57/coronin-1 regulates its interaction with actin.
REFERENCE 2 (bases 1 to 1943)
AUTHORS Castro-Castro,A., Ojeda,V., Barreira,M., Sauzeau,V.,
Navarro-Lerida,I., Muriel,O., Couceiro,J.R., Pimentel-Muinos,F.X.,
Del Pozo,M.A. and Bustelo,X.R.
TITLE Coronin 1A promotes a cytoskeletal-based feedback loop that
facilitates Rac1 translocation and activation
JOURNAL EMBO J. 30 (19), 3913-3927 (2011)
PUBMED 21873980
REMARK GeneRIF: Coronin 1A promotes a cytoskeletal-based feedback loop
that facilitates Rac1 translocation and activation
Publication Status: Online-Only
REFERENCE 3 (bases 1 to 1943)
AUTHORS Mueller,P., Liu,X. and Pieters,J.
TITLE Migration and homeostasis of naive T cells depends on coronin
1-mediated prosurvival signals and not on coronin 1-dependent
filamentous actin modulation
JOURNAL J. Immunol. 186 (7), 4039-4050 (2011)
PUBMED 21339362
REMARK GeneRIF: Instead of regulating the F-actin cytoskeleton, coronin 1
functions in balancing pro- and antiapoptotic signals by regulating
divalent calcium ion fluxes and calcineurin activation downstream
of the T cell receptor.
REFERENCE 4 (bases 1 to 1943)
AUTHORS Moriceau,S., Kantari,C., Mocek,J., Davezac,N., Gabillet,J.,
Guerrera,I.C., Brouillard,F., Tondelier,D., Sermet-Gaudelus,I.,
Danel,C., Lenoir,G., Daniel,S., Edelman,A. and Witko-Sarsat,V.
TITLE Coronin-1 is associated with neutrophil survival and is cleaved
during apoptosis: potential implication in neutrophils from cystic
fibrosis patients
JOURNAL J. Immunol. 182 (11), 7254-7263 (2009)
PUBMED 19454722
REMARK GeneRIF: Circulating neutrophils from CF patients had more
coronin-1 expression, associated with a lower apoptosis rate
REFERENCE 5 (bases 1 to 1943)
AUTHORS Shiow,L.R., Roadcap,D.W., Paris,K., Watson,S.R., Grigorova,I.L.,
Lebet,T., An,J., Xu,Y., Jenne,C.N., Foger,N., Sorensen,R.U.,
Goodnow,C.C., Bear,J.E., Puck,J.M. and Cyster,J.G.
TITLE The actin regulator coronin 1A is mutant in a thymic
egress-deficient mouse strain and in a patient with severe combined
immunodeficiency
JOURNAL Nat. Immunol. 9 (11), 1307-1315 (2008)
PUBMED 18836449
REMARK GeneRIF: Findings establish a function for coronin 1A in T cell
egress, identify a surface of coronin involved in Arp2/3
regulation.
REFERENCE 6 (bases 1 to 1943)
AUTHORS Vanguri,V.K., Wang,S., Godyna,S., Ranganathan,S. and Liau,G.
TITLE Thrombospondin-1 binds to polyhistidine with high affinity and
specificity
JOURNAL Biochem. J. 347 (PT 2), 469-473 (2000)
PUBMED 10749676
REFERENCE 7 (bases 1 to 1943)
AUTHORS Ferrari,G., Langen,H., Naito,M. and Pieters,J.
TITLE A coat protein on phagosomes involved in the intracellular survival
of mycobacteria
JOURNAL Cell 97 (4), 435-447 (1999)
PUBMED 10338208
REFERENCE 8 (bases 1 to 1943)
AUTHORS Okumura,M., Kung,C., Wong,S., Rodgers,M. and Thomas,M.L.
TITLE Definition of family of coronin-related proteins conserved between
humans and mice: close genetic linkage between coronin-2 and
CD45-associated protein
JOURNAL DNA Cell Biol. 17 (9), 779-787 (1998)
PUBMED 9778037
REFERENCE 9 (bases 1 to 1943)
AUTHORS Grogan,A., Reeves,E., Keep,N., Wientjes,F., Totty,N.F.,
Burlingame,A.L., Hsuan,J.J. and Segal,A.W.
TITLE Cytosolic phox proteins interact with and regulate the assembly of
coronin in neutrophils
JOURNAL J. Cell. Sci. 110 (PT 24), 3071-3081 (1997)
PUBMED 9365277
REFERENCE 10 (bases 1 to 1943)
AUTHORS Suzuki,K., Nishihata,J., Arai,Y., Honma,N., Yamamoto,K., Irimura,T.
and Toyoshima,S.
TITLE Molecular cloning of a novel actin-binding protein, p57, with a WD
repeat and a leucine zipper motif
JOURNAL FEBS Lett. 364 (3), 283-288 (1995)
PUBMED 7758584
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DC408372.1, DA256300.1,
AK314714.1, U34690.1 and BC110374.1.
On Sep 9, 2010 this sequence version replaced gi:300934761.
Summary: This gene encodes a member of the WD repeat protein
family. WD repeats are minimally conserved regions of approximately
40 amino acids typically bracketed by gly-his and trp-asp (GH-WD),
which may facilitate formation of heterotrimeric or multiprotein
complexes. Members of this family are involved in a variety of
cellular processes, including cell cycle progression, signal
transduction, apoptosis, and gene regulation. Alternative splicing
results in multiple transcript variants. A related pseudogene has
been defined on chromosome 16. [provided by RefSeq, Sep 2010].
Transcript Variant: This variant (1) represents the longer
transcript. Both variants 1 and 2 encode the same protein.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AK314714.1 [ECO:0000332]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-109 DC408372.1 1-109
110-199 DA256300.1 98-187
200-770 AK314714.1 1-571
771-771 U34690.1 428-428
772-1821 AK314714.1 573-1622
1822-1943 BC110374.1 1521-1642
FEATURES Location/Qualifiers
source 1..1943
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="16"
/map="16p11.2"
gene 1..1943
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/note="coronin, actin binding protein, 1A"
/db_xref="GeneID:11151"
/db_xref="HGNC:2252"
/db_xref="MIM:605000"
exon 1..316
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 110
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:930392"
variation 224
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="g"
/replace="t"
/db_xref="dbSNP:186185074"
STS 249..1898
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/db_xref="UniSTS:486443"
variation 284
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:11555340"
STS 297..1860
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/db_xref="UniSTS:494834"
exon 317..434
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 380
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:372973829"
misc_feature 385..387
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/note="upstream in-frame stop codon"
exon 435..633
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
CDS 436..1821
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/note="coronin-1; clipin-A; coronin-like protein A;
coronin-like protein p57; tryptophan aspartate-containing
coat protein"
/codon_start=1
/product="coronin-1A"
/protein_id="NP_001180262.1"
/db_xref="GI:300934762"
/db_xref="CCDS:CCDS10673.1"
/db_xref="GeneID:11151"
/db_xref="HGNC:2252"
/db_xref="MIM:605000"
/translation="
MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIYSVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
"
misc_feature 439..441
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="N-acetylserine; propagated from
UniProtKB/Swiss-Prot (P31146.4); acetylation site"
misc_feature 439..441
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by PKC; propagated from
UniProtKB/Swiss-Prot (P31146.4); phosphorylation site"
misc_feature 445..639
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/note="Domain of unknown function (DUF1899); Region:
DUF1899; pfam08953"
/db_xref="CDD:149883"
misc_feature 460..1818
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/note="coronin; Provisional; Region: PTZ00421"
/db_xref="CDD:173611"
misc_feature 472..624
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P31146.4);
Region: WD 1"
misc_feature 652..765
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P31146.4);
Region: WD 2"
misc_feature 661..1341
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/note="WD40 domain, found in a number of eukaryotic
proteins that cover a wide variety of functions including
adaptor/regulatory modules in signal transduction,
pre-mRNA processing and cytoskeleton assembly; typically
contains a GH dipeptide 11-24 residues from...; Region:
WD40; cl02567"
/db_xref="CDD:207648"
misc_feature order(670..675,730..732,742..744,760..765,820..825,
877..879,892..894,910..915,958..960,1009..1011,1024..1026,
1042..1047,1093..1095,1141..1143,1165..1167,1183..1188,
1222..1224,1231..1233,1285..1287,1300..1302,1318..1323)
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/note="structural tetrad; other site"
/db_xref="CDD:29257"
misc_feature 802..915
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P31146.4);
Region: WD 3"
misc_feature 925..1047
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P31146.4);
Region: WD 4"
misc_feature 1054..1188
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P31146.4);
Region: WD 5"
misc_feature 1207..1611
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/note="Domain of unknown function (DUF1900); Region:
DUF1900; pfam08954"
/db_xref="CDD:149884"
misc_feature 1207..1323
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P31146.4);
Region: WD 6"
misc_feature 1339..1482
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P31146.4);
Region: WD 7"
misc_feature 1669..1671
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine, by PKC; propagated from
UniProtKB/Swiss-Prot (P31146.4); phosphorylation site"
misc_feature 1780..1782
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P31146.4); acetylation site"
variation 489
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="g"
/db_xref="dbSNP:61736363"
variation 517
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:201747422"
variation 554
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="g"
/replace="t"
/db_xref="dbSNP:79062603"
variation 603
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:75142051"
exon 634..756
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 656
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:373022238"
variation 672
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:201766395"
variation 673
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="g"
/db_xref="dbSNP:11555342"
variation 708
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:141844867"
variation 720
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:184262856"
variation 754
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="c"
/db_xref="dbSNP:201579444"
exon 757..886
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 771
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:1132812"
variation 781
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:138146826"
variation 796
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:370896577"
variation 802
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="c"
/db_xref="dbSNP:201721540"
variation 804
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:200437355"
variation 807
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:149599538"
variation 808
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:143294920"
variation 825
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:201119953"
exon 887..1071
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 929
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:371653086"
variation 930
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:374849081"
variation 954
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:199752871"
variation 975
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:369595327"
variation 992
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:148312916"
variation 996
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:141746241"
variation 1039
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:145989561"
variation 1065
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:139989282"
variation 1066
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:371818902"
exon 1072..1191
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 1081
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:377504027"
variation 1084
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="c"
/db_xref="dbSNP:141827038"
variation 1119
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:371077364"
variation 1146
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:374088140"
variation 1173
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:143729497"
variation 1179
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:200060318"
exon 1192..1296
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 1209
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:187747730"
variation 1211
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="t"
/db_xref="dbSNP:200963965"
variation 1227
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:139024575"
variation 1239
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:149867063"
variation 1272
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:113875403"
variation 1278
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:199650298"
exon 1297..1442
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 1371
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:148629867"
variation 1380
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="g"
/db_xref="dbSNP:144860668"
variation 1389
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="c"
/db_xref="dbSNP:376912665"
variation 1431
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:199960741"
STS 1434..1571
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/standard_name="RH47208"
/db_xref="UniSTS:88686"
variation 1437
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:377351892"
exon 1443..1500
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 1462
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="c"
/db_xref="dbSNP:112289496"
variation 1467
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:199896375"
exon 1501..1716
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 1509
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="g"
/db_xref="dbSNP:376540649"
variation 1512
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:147924993"
variation 1532
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="c"
/db_xref="dbSNP:150857828"
variation 1536
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:139282852"
variation 1581
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:201734831"
variation 1583
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:61736366"
variation 1596
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:375181897"
variation 1607
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:375532115"
variation 1623
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:151106018"
variation 1624
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:35967690"
variation 1639
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:150186033"
variation 1645
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:11555339"
variation 1649
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="g"
/replace="t"
/db_xref="dbSNP:369828613"
variation 1657
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:373093101"
variation 1668
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="c"
/replace="t"
/db_xref="dbSNP:138821284"
variation 1674
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:199576607"
variation 1679
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:1804109"
exon 1717..1933
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/inference="alignment:Splign:1.39.8"
variation 1762
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="c"
/db_xref="dbSNP:1053574"
variation 1779
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
/replace="a"
/replace="g"
/db_xref="dbSNP:3209337"
polyA_signal 1909..1914
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
polyA_site 1933
/gene="CORO1A"
/gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
ORIGIN
aaaaagaagtttagattcgcttcccggagccgggatggcagcctgcgctatggttggggaccaacgtggtgcacgggcaggggccggggagagaggcggccgcagcgggagcccgggagcgcagggcgggcctggaagagctccgccccaaggggcgcggccaccccggaggcgggcgcacggctgcttctcattcattgtcttgacaagagcatcttcagcgggcgagtccccggctcctccagctccttcctcctcttcctcctcctcctccacctccggcttttgggggatcactgtcctctctcggcagcagatacaggctgctcctcaagactggggctcttcacatacgctcctcaccgctctttgggcaggccgacctagcagcctcttcgggagtcctggggtggccgggggtgctggagcccccaaatgagccggcaggtggtccgctccagcaagttccgccacgtgtttggacagccggccaaggccgaccagtgctatgaagatgtgcgcgtctcacagaccacctgggacagtggcttctgtgctgtcaaccctaagtttgtggccctgatctgtgaggccagcgggggaggggccttcctggtgctgcccctgggcaagactggacgtgtggacaagaatgcgcccacggtctgtggccacacagcccctgtgctagacatcgcctggtgcccgcacaatgacaacgtcattgccagtggctccgaggactgcacagtcatggtgtgggagatcccagatgggggcctgatgctgcccctgcgggagcccgtcgtcaccctggagggccacaccaagcgtgtgggcattgtggcctggcacaccacagcccagaacgtgctgctcagtgcaggttgtgacaacgtgatcatggtgtgggacgtgggcactggggcggccatgctgacactgggcccagaggtgcacccagacacgatctacagtgtggactggagccgagatggaggcctcatttgtacctcctgccgtgacaagcgcgtgcgcatcatcgagccccgcaaaggcactgtcgtagctgagaaggaccgtccccacgaggggacccggcccgtgcgtgcagtgttcgtgtcggaggggaagatcctgaccacgggcttcagccgcatgagtgagcggcaggtggcgctgtgggacacaaagcacctggaggagccgctgtccctgcaggagctggacaccagcagcggtgtcctgctgcccttctttgaccctgacaccaacatcgtctacctctgtggcaagggtgacagctcaatccggtactttgagatcacttccgaggcccctttcctgcactatctctccatgttcagttccaaggagtcccagcggggcatgggctacatgcccaaacgtggcctggaggtgaacaagtgtgagatcgccaggttctacaagctgcacgagcggaggtgtgagcccattgccatgacagtgcctcgaaagtcggacctgttccaggaggacctgtacccacccaccgcagggcccgaccctgccctcacggctgaggagtggctggggggtcgggatgctgggcccctcctcatctccctcaaggatggctacgtacccccaaagagccgggagctgagggtcaaccggggcctggacaccgggcgcaggagggcagcaccagaggccagtggcactcccagctcggatgccgtgtctcggctggaggaggagatgcggaagctccaggccacggtgcaggagctccagaagcgcttggacaggctggaggagacagtccaggccaagtagagccccgcagggcctccagcagggtcagccattcacacccatccactcacctcccattcccagccacatggcagagaaaaaaatcataataaaatggctttattttctggtaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:11151 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:11151 -> Molecular function: GO:0008022 [protein C-terminus binding] evidence: IPI
GeneID:11151 -> Molecular function: GO:0008092 [cytoskeletal protein binding] evidence: ISS
GeneID:11151 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IDA
GeneID:11151 -> Molecular function: GO:0043548 [phosphatidylinositol 3-kinase binding] evidence: IDA
GeneID:11151 -> Molecular function: GO:0051015 [actin filament binding] evidence: IDA
GeneID:11151 -> Biological process: GO:0001845 [phagolysosome assembly] evidence: IMP
GeneID:11151 -> Biological process: GO:0006816 [calcium ion transport] evidence: IEA
GeneID:11151 -> Biological process: GO:0006909 [phagocytosis] evidence: IMP
GeneID:11151 -> Biological process: GO:0006928 [cellular component movement] evidence: NAS
GeneID:11151 -> Biological process: GO:0007015 [actin filament organization] evidence: IEA
GeneID:11151 -> Biological process: GO:0008360 [regulation of cell shape] evidence: IBA
GeneID:11151 -> Biological process: GO:0030036 [actin cytoskeleton organization] evidence: IMP
GeneID:11151 -> Biological process: GO:0030335 [positive regulation of cell migration] evidence: IEA
GeneID:11151 -> Biological process: GO:0030595 [leukocyte chemotaxis] evidence: IBA
GeneID:11151 -> Biological process: GO:0030833 [regulation of actin filament polymerization] evidence: IEA
GeneID:11151 -> Biological process: GO:0031589 [cell-substrate adhesion] evidence: IMP
GeneID:11151 -> Biological process: GO:0032796 [uropod organization] evidence: IBA
GeneID:11151 -> Biological process: GO:0042102 [positive regulation of T cell proliferation] evidence: IEA
GeneID:11151 -> Biological process: GO:0043029 [T cell homeostasis] evidence: IEA
GeneID:11151 -> Biological process: GO:0045087 [innate immune response] evidence: NAS
GeneID:11151 -> Biological process: GO:0048873 [homeostasis of number of cells within a tissue] evidence: IEA
GeneID:11151 -> Biological process: GO:0050918 [positive chemotaxis] evidence: IDA
GeneID:11151 -> Biological process: GO:0051126 [negative regulation of actin nucleation] evidence: IDA
GeneID:11151 -> Biological process: GO:0071353 [cellular response to interleukin-4] evidence: IEA
GeneID:11151 -> Cellular component: GO:0001772 [immunological synapse] evidence: IEA
GeneID:11151 -> Cellular component: GO:0001891 [phagocytic cup] evidence: IDA
GeneID:11151 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:11151 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:11151 -> Cellular component: GO:0005884 [actin filament] evidence: IDA
GeneID:11151 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA
GeneID:11151 -> Cellular component: GO:0030027 [lamellipodium] evidence: IDA
GeneID:11151 -> Cellular component: GO:0030670 [phagocytic vesicle membrane] evidence: IEA
GeneID:11151 -> Cellular component: GO:0030864 [cortical actin cytoskeleton] evidence: IDA
GeneID:11151 -> Cellular component: GO:0043234 [protein complex] evidence: IDA
GeneID:11151 -> Cellular component: GO:0045335 [phagocytic vesicle] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.