2024-04-19 17:55:40, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001185149 663 bp mRNA linear PRI 07-JUL-2013 DEFINITION Homo sapiens claudin 24 (CLDN24), mRNA. ACCESSION NM_001185149 XM_001714660 XM_001716940 XM_001716970 VERSION NM_001185149.1 GI:297632382 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 663) AUTHORS Lal-Nag,M. and Morin,P.J. TITLE The claudins JOURNAL Genome Biol. 10 (8), 235 (2009) PUBMED 19706201 REMARK Review article REFERENCE 2 (bases 1 to 663) AUTHORS Krause,G., Winkler,L., Mueller,S.L., Haseloff,R.F., Piontek,J. and Blasig,I.E. TITLE Structure and function of claudins JOURNAL Biochim. Biophys. Acta 1778 (3), 631-645 (2008) PUBMED 18036336 REMARK Review article REFERENCE 3 (bases 1 to 663) AUTHORS Katoh,M. and Katoh,M. TITLE CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family JOURNAL Int. J. Mol. Med. 11 (6), 683-689 (2003) PUBMED 12736707 REMARK GeneRIF: CLDN21, clustered with CLDN22 at human chromosome 4q35.1, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. REFERENCE 4 (bases 1 to 663) AUTHORS Gonzalez-Mariscal,L., Betanzos,A., Nava,P. and Jaramillo,B.E. TITLE Tight junction proteins JOURNAL Prog. Biophys. Mol. Biol. 81 (1), 1-44 (2003) PUBMED 12475568 REMARK Review article REFERENCE 5 (bases 1 to 663) AUTHORS Tsukita,S. and Furuse,M. TITLE Claudin-based barrier in simple and stratified cellular sheets JOURNAL Curr. Opin. Cell Biol. 14 (5), 531-536 (2002) PUBMED 12231346 REMARK Review article REFERENCE 6 (bases 1 to 663) AUTHORS Tsukita,S., Furuse,M. and Itoh,M. TITLE Multifunctional strands in tight junctions JOURNAL Nat. Rev. Mol. Cell Biol. 2 (4), 285-293 (2001) PUBMED 11283726 REMARK Review article REFERENCE 7 (bases 1 to 663) AUTHORS Heiskala,M., Peterson,P.A. and Yang,Y. TITLE The roles of claudin superfamily proteins in paracellular transport JOURNAL Traffic 2 (2), 93-98 (2001) PUBMED 11247307 REMARK Review article REFERENCE 8 (bases 1 to 663) AUTHORS Kniesel,U. and Wolburg,H. TITLE Tight junctions of the blood-brain barrier JOURNAL Cell. Mol. Neurobiol. 20 (1), 57-76 (2000) PUBMED 10690502 REMARK Review article COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC093844.3. On or before Jun 9, 2010 this sequence version replaced gi:169166401, gi:169166930, gi:169167238. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The protein encoded by this gene is 75% identical to the mouse homolog. This gene is upstream of the CLDN22 gene, which overlaps the WWC2 gene on the opposite strand in the genome.[provided by RefSeq, Aug 2010]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-663 AC093844.3 114072-114734 c FEATURES Location/Qualifiers source 1..663 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="4" /map="4q35.1" gene 1..663 /gene="CLDN24" /gene_synonym="CLDN21" /note="claudin 24" /db_xref="GeneID:100132463" /db_xref="HGNC:37200" CDS 1..663 /gene="CLDN24" /gene_synonym="CLDN21" /note="claudin 21" /codon_start=1 /product="putative claudin-24" /protein_id="NP_001172078.1" /db_xref="GI:297632383" /db_xref="CCDS:CCDS54824.1" /db_xref="GeneID:100132463" /db_xref="HGNC:37200" /translation="
MALIFRTAMQSVGLLLSLLGWILSIITTYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEVGMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLILGGILSWASGITALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGGCLLNCAACSSHAPLALGHYAVAQMQTQCPYLEDGTADPQV
" misc_feature 31..93 /gene="CLDN24" /gene_synonym="CLDN21" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (A6NM45.2); transmembrane region" misc_feature <145..510 /gene="CLDN24" /gene_synonym="CLDN21" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl15797" /db_xref="CDD:210197" misc_feature 244..306 /gene="CLDN24" /gene_synonym="CLDN21" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (A6NM45.2); transmembrane region" misc_feature 352..414 /gene="CLDN24" /gene_synonym="CLDN21" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (A6NM45.2); transmembrane region" misc_feature 484..546 /gene="CLDN24" /gene_synonym="CLDN21" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (A6NM45.2); transmembrane region" exon 1..663 /gene="CLDN24" /gene_synonym="CLDN21" /inference="alignment:Splign:1.39.8" variation complement(39) /gene="CLDN24" /gene_synonym="CLDN21" /replace="a" /replace="g" /db_xref="dbSNP:184328199" variation complement(48) /gene="CLDN24" /gene_synonym="CLDN21" /replace="a" /replace="c" /db_xref="dbSNP:115750927" variation complement(52) /gene="CLDN24" /gene_synonym="CLDN21" /replace="c" /replace="t" /db_xref="dbSNP:7688467" variation complement(90) /gene="CLDN24" /gene_synonym="CLDN21" /replace="a" /replace="g" /db_xref="dbSNP:376740595" variation complement(175) /gene="CLDN24" /gene_synonym="CLDN21" /replace="a" /replace="g" /db_xref="dbSNP:202026421" variation complement(289) /gene="CLDN24" /gene_synonym="CLDN21" /replace="a" /replace="g" /db_xref="dbSNP:141964006" variation complement(391) /gene="CLDN24" /gene_synonym="CLDN21" /replace="a" /replace="g" /db_xref="dbSNP:148134118" variation complement(409) /gene="CLDN24" /gene_synonym="CLDN21" /replace="a" /replace="g" /db_xref="dbSNP:201161896" variation complement(512) /gene="CLDN24" /gene_synonym="CLDN21" /replace="c" /replace="t" /db_xref="dbSNP:147080744" variation complement(574) /gene="CLDN24" /gene_synonym="CLDN21" /replace="a" /replace="g" /db_xref="dbSNP:200355020" variation complement(621) /gene="CLDN24" /gene_synonym="CLDN21" /replace="c" /replace="g" /db_xref="dbSNP:6839940" variation complement(631) /gene="CLDN24" /gene_synonym="CLDN21" /replace="c" /replace="t" /db_xref="dbSNP:142081383" ORIGIN
atggctttaatctttagaacagcaatgcaatctgttggacttttactatctctcctgggatggattttatccattattacaacttatttgccacactggaagaacctcaacctggacttaaatgaaatggaaaactggaccatgggactctggcaaacctgtgtcatccaagaggaagtggggatgcaatgcaaggactttgactccttcctggctttgcctgctgaactcagggtctccaggatcttaatgtttctgtcaaatgggctgggatttctgggcctgctggtctctgggtttggcctggactgtttgagaattggagagagtcagagagatctcaagaggcgactgctcattctgggaggaattctgtcctgggcctcgggaatcacagccctggttcccgtctcttgggttgcccacaagacggttcaggagttctgggatgagaacgtcccagactttgtccccaggtgggagtttggggaggccctgtttctgggctggtttgctggactttctcttctgctaggagggtgtctgctcaactgcgcagcctgctccagccacgctcccctagctttgggccactatgcagtggcgcaaatgcaaactcagtgtccctacctggaagatgggacagcagatcctcaagtgtaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:100132463 -> Molecular function: GO:0005198 [structural molecule activity] evidence: IEA GeneID:100132463 -> Cellular component: GO:0005886 [plasma membrane] evidence: IEA GeneID:100132463 -> Cellular component: GO:0005923 [tight junction] evidence: IEA GeneID:100132463 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.