GGRNA Home | Help | Advanced search

2024-04-27 09:50:28, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001160100            2601 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens claudin 10 (CLDN10), transcript variant a_v1, mRNA.
ACCESSION   NM_001160100
VERSION     NM_001160100.1  GI:231569234
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2601)
  AUTHORS   Huang,G.W., Ding,X., Chen,S.L. and Zeng,L.
  TITLE     Expression of claudin 10 protein in hepatocellular carcinoma:
            impact on survival
  JOURNAL   J. Cancer Res. Clin. Oncol. 137 (8), 1213-1218 (2011)
   PUBMED   21647678
  REMARK    GeneRIF: Claudin 10 protein is highly expressed in hepatocellular
            carcinoma (HCC) tissue and is closely related to angiogenesis. It
            could be a useful marker to predict poor prognosis of HCC patients
            after hepatectomy.
REFERENCE   2  (bases 1 to 2601)
  AUTHORS   Merikallio,H., Paakko,P., Harju,T. and Soini,Y.
  TITLE     Claudins 10 and 18 are predominantly expressed in lung
            adenocarcinomas and in tumors of nonsmokers
  JOURNAL   Int J Clin Exp Pathol 4 (7), 667-673 (2011)
   PUBMED   22076167
  REMARK    GeneRIF: Claudin 10/18 are most commonly expressed in lung
            adenocarcinomas. Female patients and non-smokers express these
            claudins more commonly suggesting that they may play a part in the
            carcinogenesis of tobacco unrelated carcinoma.
REFERENCE   3  (bases 1 to 2601)
  AUTHORS   Seo,H.W., Rengaraj,D., Choi,J.W., Ahn,S.E., Song,Y.S., Song,G. and
            Han,J.Y.
  TITLE     Claudin 10 is a glandular epithelial marker in the chicken model as
            human epithelial ovarian cancer
  JOURNAL   Int. J. Gynecol. Cancer 20 (9), 1465-1473 (2010)
   PUBMED   21370593
  REMARK    GeneRIF: CLDN10 is a novel biomarker for detecting ovarian cancer
            in the chicken, a suitable animal model for investigating the
            effect and function of CLDN in human ovarian cancer.
REFERENCE   4  (bases 1 to 2601)
  AUTHORS   Ouban,A. and Ahmed,A.A.
  TITLE     Claudins in human cancer: a review
  JOURNAL   Histol. Histopathol. 25 (1), 83-90 (2010)
   PUBMED   19924644
  REMARK    Review article
REFERENCE   5  (bases 1 to 2601)
  AUTHORS   Lal-Nag,M. and Morin,P.J.
  TITLE     The claudins
  JOURNAL   Genome Biol. 10 (8), 235 (2009)
   PUBMED   19706201
  REMARK    Review article
REFERENCE   6  (bases 1 to 2601)
  AUTHORS   Christian,S.L., McDonough,J., Liu Cy,C.Y., Shaikh,S., Vlamakis,V.,
            Badner,J.A., Chakravarti,A. and Gershon,E.S.
  TITLE     An evaluation of the assembly of an approximately 15-Mb region on
            human chromosome 13q32-q33 linked to bipolar disorder and
            schizophrenia
  JOURNAL   Genomics 79 (5), 635-656 (2002)
   PUBMED   11991713
REFERENCE   7  (bases 1 to 2601)
  AUTHORS   Tsukita,S., Furuse,M. and Itoh,M.
  TITLE     Multifunctional strands in tight junctions
  JOURNAL   Nat. Rev. Mol. Cell Biol. 2 (4), 285-293 (2001)
   PUBMED   11283726
  REMARK    Review article
REFERENCE   8  (bases 1 to 2601)
  AUTHORS   Heiskala,M., Peterson,P.A. and Yang,Y.
  TITLE     The roles of claudin superfamily proteins in paracellular transport
  JOURNAL   Traffic 2 (2), 93-98 (2001)
   PUBMED   11247307
  REMARK    Review article
REFERENCE   9  (bases 1 to 2601)
  AUTHORS   Kniesel,U. and Wolburg,H.
  TITLE     Tight junctions of the blood-brain barrier
  JOURNAL   Cell. Mol. Neurobiol. 20 (1), 57-76 (2000)
   PUBMED   10690502
  REMARK    Review article
REFERENCE   10 (bases 1 to 2601)
  AUTHORS   Kubota,K., Furuse,M., Sasaki,H., Sonoda,N., Fujita,K., Nagafuchi,A.
            and Tsukita,S.
  TITLE     Ca(2+)-independent cell-adhesion activity of claudins, a family of
            integral membrane proteins localized at tight junctions
  JOURNAL   Curr. Biol. 9 (18), 1035-1038 (1999)
   PUBMED   10508613
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DA636757.1, AK055855.1,
            BG697724.1 and DB544708.1.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. The expression level of this gene is
            associated with recurrence of primary hepatocellular carcinoma. Six
            alternatively spliced transcript variants encoding different
            isoforms have been reported, but the transcript sequences of some
            variants are not determined.[provided by RefSeq, Jun 2010].
            
            Transcript Variant: This variant (a_v1) uses an alternate in-frame
            splice site in the 5' coding region, compared to variant a. The
            resulting isoform (a_i1) lacks an internal segment near the
            N-terminus, compared to isoform a.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns ERS025084,
                              ERS025088 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-5                 DA636757.1         1-5
            6-392               AK055855.1         1-387
            393-1821            AK055855.1         445-1873
            1822-1822           BG697724.1         197-197
            1823-2294           AK055855.1         1875-2346
            2295-2295           BG697724.1         669-669
            2296-2497           AK055855.1         2348-2549
            2498-2601           DB544708.1         335-438
FEATURES             Location/Qualifiers
     source          1..2601
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="13"
                     /map="13q31-q34"
     gene            1..2601
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /note="claudin 10"
                     /db_xref="GeneID:9071"
                     /db_xref="HGNC:2033"
     exon            1..392
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    146..148
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /note="upstream in-frame stop codon"
     CDS             236..859
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /note="isoform a_i1 is encoded by transcript variant a_v1;
                     claudin-10; OSP-like protein"
                     /codon_start=1
                     /product="claudin-10 isoform a_i1"
                     /protein_id="NP_001153572.1"
                     /db_xref="GI:231569235"
                     /db_xref="GeneID:9071"
                     /db_xref="HGNC:2033"
                     /translation="
MSRAQIWALVSGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCAGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV
"
     misc_feature    260..709
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl15797"
                     /db_xref="CDD:210197"
     exon            393..554
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /inference="alignment:Splign:1.39.8"
     exon            555..636
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /inference="alignment:Splign:1.39.8"
     exon            637..744
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /inference="alignment:Splign:1.39.8"
     exon            745..2601
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /inference="alignment:Splign:1.39.8"
     STS             760..943
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /standard_name="CLDN10"
                     /db_xref="UniSTS:505369"
     STS             872..1056
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /standard_name="RH13730"
                     /db_xref="UniSTS:61949"
     STS             872..992
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /standard_name="RH71267"
                     /db_xref="UniSTS:46842"
     polyA_signal    1062..1067
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
     polyA_site      1083
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
     STS             1111..1338
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /standard_name="D13S1156"
                     /db_xref="UniSTS:11282"
     STS             1184..1338
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /standard_name="D13S846E"
                     /db_xref="UniSTS:151518"
     variation       complement(1582)
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1952106"
     polyA_signal    2581..2586
                     /gene="CLDN10"
                     /gene_synonym="CPETRL3; OSP-L"
ORIGIN      
aataaatatccgtgtagaaaatcagaacgactctttcaggccatctttaaaatgtcattggtaaaccatacttgatcctaaattcctgtacttcctcaggccatccgagcatgaaacgctgtcacctacccacatccgctggctgtgacgcttgtcaaagtgttctctatcggctgcatgcctagaccaccaaagcgttctgaccggacagtgtcactggagaaggcggcgcgacatgtccagggcgcagatctgggctctggtgtctggtgtcggagggtttggagctctcgttgctgctaccacgtccaatgagtggaaagtgaccacgcgagcctcctcggtgataacagccacttgggtttaccagggtctgtggatgaactgcgcaggttatatacaggcatgtagaggacttatgatcgctgctgtcagcctgggcttctttggttccatatttgcgctctttggaatgaagtgtaccaaagtcggaggctccgataaagccaaagctaaaattgcttgtttggctgggattgtattcatactgtcagggctgtgctcaatgactggatgttccctatatgcaaacaaaatcacaacggaattctttgatcctctctttgttgagcaaaagtatgaattaggagccgctctgtttattggatgggcaggagcctcactgtgcataattggtggtgtcatattttgcttttcaatatctgacaacaacaaaacacccagatacacatacaacggggccacatctgtcatgtcttctcggacaaagtatcatggtggagaagattttaaaacaacaaacccttcaaaacagtttgataaaaatgcttatgtctaaaagagctcgctggcaagctgcctcttgagtttgttataaaagcgaactgttcacaaaatgatcccatcaaggccctcccataattaacactcaaaactatttttaaaatatgcatttgaagcatctgttgattgtatggatgtaagtgttcttacatagttagttatatactaatcattttctgttgtggctttctataaaaaataaacagtttatttacaggatttgtaaaatgttttctacatttatatagaacatgaaaagcatttagtaccaaaggttcaagaagtattcgtactctagcctttttaatcattcatagatagaagtctttgtacccactccttatgtttcttttcattcataaacaggtgtataaggaacaatgtcttataaacagcatgggggcaatctgagaatattcctcaaaaggtgtccaggttaaatagacatgttactggctgcacacaggcaaattctagtttgttttttttaagtattctacaacatttatttaaaaaggtaaatctttttgttgaagcagcaagttatctggtagaacttaacttctacaggatcagagaggatcttgctcattcatggccatatccacatgcccatggccactcagtagattgttgaaaaagcaaagccacaccattctctttgatgtatgcagagagttacgtagcaggggatgttctctgatttattccactggcaccattagtgaatatttagttgttttcataaacgatgctgtgatgaagactcatgtacatatttagcaaattttggtttcttacatgtgcctgtcatgactgtaattcattatgactgctccaggaagggctaatggggccaatatattattgcctgtcatgtggcacatccatgttaaggggctgaggcgtccctggcacggaatgcagagccctgagctagggcatcagcagaagctgagatagagatattggtcatggttgactgaggagccaattaaaacctgtttatgcctagtgttccattattggaacactaagcatgtgggagttatttatatcctactgctcaaggtcatcgccaaggtgtgattggaaaaattcaaaaaattgcaacctcaggcataaatgggttaaggacatcccaagcccaagtggtacgtgcctcactcagaactgacgggccgagttctatctaggtgtgtcttccagaacctgtttacggctaactggataactgagagacttgtcatttctaaagacatttaagttgctccagggatttctgaaaaaagacacaggcttcttcctagagccagccctatataacatgcccacaagggcaacagttatcacagttcatacacacctttcatgtcctgtctcactcactcctcacagccatcctaggagatacatattgttttcatcctgcatttacagaaaaagaaatgaaaacagagagcttaaataatttgccacagtaatgtcgaaactaggcctttgaaccaaggcagtctagggtaaaatatagtttcaaagtatgaataagaattggtatttgtgttatctttgagtaagaaactgtccgatatgaatcacaacgtgggtgaatgtagtattttcctgaagtgtgaaagacttaaaaaaaagaatcacattgttcagaggtgctcaatggaaagaaaaggaaatgaacaagtttgttaaaagataaaaaataaaaaaaattccatacct
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:9071 -> Molecular function: GO:0005198 [structural molecule activity] evidence: IEA
            GeneID:9071 -> Molecular function: GO:0042802 [identical protein binding] evidence: ISS
            GeneID:9071 -> Biological process: GO:0007155 [cell adhesion] evidence: TAS
            GeneID:9071 -> Biological process: GO:0016338 [calcium-independent cell-cell adhesion] evidence: ISS
            GeneID:9071 -> Cellular component: GO:0005886 [plasma membrane] evidence: IEA
            GeneID:9071 -> Cellular component: GO:0005923 [tight junction] evidence: ISS
            GeneID:9071 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.