Home |
Help |
Advanced search
2024-04-23 22:29:16, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001146191 4576 bp mRNA linear PRI 14-MAY-2013
DEFINITION Homo sapiens myelin protein zero-like 1 (MPZL1), transcript variant
3, mRNA.
ACCESSION NM_001146191
VERSION NM_001146191.1 GI:226054870
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 4576)
AUTHORS Cummings,A.C., Jiang,L., Velez Edwards,D.R., McCauley,J.L.,
Laux,R., McFarland,L.L., Fuzzell,D., Knebusch,C., Caywood,L.,
Reinhart-Mercer,L., Nations,L., Gilbert,J.R., Konidari,I.,
Tramontana,M., Cuccaro,M.L., Scott,W.K., Pericak-Vance,M.A. and
Haines,J.L.
TITLE Genome-wide association and linkage study in the Amish detects a
novel candidate late-onset Alzheimer disease gene
JOURNAL Ann. Hum. Genet. 76 (5), 342-351 (2012)
PUBMED 22881374
REFERENCE 2 (bases 1 to 4576)
AUTHORS Gallardo,E., Garcia,A., Ramon,C., Maravi,E., Infante,J., Gaston,I.,
Alonso,A., Combarros,O., De Jonghe,P. and Berciano,J.
TITLE Charcot-Marie-Tooth disease type 2J with MPZ Thr124Met mutation:
clinico-electrophysiological and MRI study of a family
JOURNAL J. Neurol. 256 (12), 2061-2071 (2009)
PUBMED 19629567
REMARK GeneRIF: Clinico-electrophysiological features and MRI findings are
described in leg musculature from three patients belonging to a
CMT2J pedigree due to MPZ Thr124Met mutation.
REFERENCE 3 (bases 1 to 4576)
AUTHORS Ehret,G.B., O'Connor,A.A., Weder,A., Cooper,R.S. and Chakravarti,A.
TITLE Follow-up of a major linkage peak on chromosome 1 reveals
suggestive QTLs associated with essential hypertension: GenNet
study
JOURNAL Eur. J. Hum. Genet. 17 (12), 1650-1657 (2009)
PUBMED 19536175
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 4 (bases 1 to 4576)
AUTHORS Cheung,C.L., Chan,B.Y., Chan,V., Ikegawa,S., Kou,I., Ngai,H.,
Smith,D., Luk,K.D., Huang,Q.Y., Mori,S., Sham,P.C. and Kung,A.W.
TITLE Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible
genetic association with bone mineral density variation
JOURNAL Hum. Mol. Genet. 18 (4), 679-687 (2009)
PUBMED 19064610
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 5 (bases 1 to 4576)
AUTHORS Kusano,K., Thomas,T.N. and Fujiwara,K.
TITLE Phosphorylation and localization of protein-zero related (PZR) in
cultured endothelial cells
JOURNAL Endothelium 15 (3), 127-136 (2008)
PUBMED 18568953
REMARK GeneRIF: Phosphorylation and localization of PZR in cultured
endothelial cells is reported.
REFERENCE 6 (bases 1 to 4576)
AUTHORS Wistow,G., Bernstein,S.L., Wyatt,M.K., Fariss,R.N., Behal,A.,
Touchman,J.W., Bouffard,G., Smith,D. and Peterson,K.
TITLE Expressed sequence tag analysis of human RPE/choroid for the
NEIBank Project: over 6000 non-redundant transcripts, novel genes
and splice variants
JOURNAL Mol. Vis. 8, 205-220 (2002)
PUBMED 12107410
REMARK Publication Status: Online-Only
REFERENCE 7 (bases 1 to 4576)
AUTHORS Zhao,R., Guerrah,A., Tang,H. and Zhao,Z.J.
TITLE Cell surface glycoprotein PZR is a major mediator of concanavalin
A-induced cell signaling
JOURNAL J. Biol. Chem. 277 (10), 7882-7888 (2002)
PUBMED 11751924
REMARK GeneRIF: PZR is a major receptor of ConA and has an important role
in cell signaling via c-Src. Considering the various biological
activities of ConA, the study of PZR may have major therapeutic
implications
REFERENCE 8 (bases 1 to 4576)
AUTHORS Zhao,R. and Zhao,Z.J.
TITLE Dissecting the interaction of SHP-2 with PZR, an immunoglobulin
family protein containing immunoreceptor tyrosine-based inhibitory
motifs
JOURNAL J. Biol. Chem. 275 (8), 5453-5459 (2000)
PUBMED 10681522
REFERENCE 9 (bases 1 to 4576)
AUTHORS Tang,D.S., Yu,K.P., Tang,X.X., Zhang,H.L., Pan,Q., Dai,H.P. and
Xia,J.H.
TITLE Cloning of Human Myelin Protein Zero-like Genes by Bioinformatics
Strategy
JOURNAL Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 32 (4), 364-368 (2000)
PUBMED 12075424
REFERENCE 10 (bases 1 to 4576)
AUTHORS Zhao,Z.J. and Zhao,R.
TITLE Purification and cloning of PZR, a binding protein and putative
physiological substrate of tyrosine phosphatase SHP-2
JOURNAL J. Biol. Chem. 273 (45), 29367-29372 (1998)
PUBMED 9792637
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
DA725074.1, AK297112.1, Z99943.1 and AW292498.1.
Transcript Variant: This variant (3) lacks three alternate exons in
the 3' coding region that results in a frameshift, compared to
variant 1. The encoded isoform (c) is shorter than isoform a.
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC000984.1, AK297112.1 [ECO:0000332]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-29 DA725074.1 1-29
30-1124 AK297112.1 1-1095
1125-4269 Z99943.1 64781-67925
4270-4576 AW292498.1 1-307 c
FEATURES Location/Qualifiers
source 1..4576
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1q24.2"
gene 1..4576
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/note="myelin protein zero-like 1"
/db_xref="GeneID:9019"
/db_xref="HGNC:7226"
/db_xref="MIM:604376"
exon 1..293
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/inference="alignment:Splign:1.39.8"
CDS 203..562
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/note="isoform c precursor is encoded by transcript
variant 3; protein zero related; myelin protein zero-like
protein 1; immunoglobulin family transmembrane protein;
protein zero-related"
/codon_start=1
/product="myelin protein zero-like protein 1 isoform c
precursor"
/protein_id="NP_001139663.1"
/db_xref="GI:226054871"
/db_xref="CCDS:CCDS53425.1"
/db_xref="GeneID:9019"
/db_xref="HGNC:7226"
/db_xref="MIM:604376"
/translation="
MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
"
sig_peptide 203..313
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
misc_feature 317..>460
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/note="Immunoglobulin domain; Region: Ig; cl11960"
/db_xref="CDD:213125"
variation 242
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:113319606"
variation 243
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:368926182"
exon 294..460
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/inference="alignment:Splign:1.39.8"
variation 319
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:200435022"
variation 338
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:369822857"
variation 372
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:375713174"
variation 397
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:150711804"
variation 404
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:146968580"
variation 415
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:143448673"
variation 418
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:201705663"
variation 450
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:369996563"
exon 461..4560
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/inference="alignment:Splign:1.39.8"
variation 483
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="g"
/replace="t"
/db_xref="dbSNP:146099511"
variation 493
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:139028868"
variation 497
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:146869026"
variation 514..515
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace=""
/replace="t"
/db_xref="dbSNP:34626910"
STS 524..680
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="SHGC-75878"
/db_xref="UniSTS:7599"
variation 543
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:375874838"
variation 544
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:200004895"
variation 552
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:190661858"
variation 574
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:377498586"
variation 697
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:141592237"
variation 733
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="g"
/replace="t"
/db_xref="dbSNP:150901710"
variation 748
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:78809449"
variation 843
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:182898542"
variation 844
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:185441444"
variation 887
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:190151302"
variation 1012
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:41270734"
variation 1146
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:182824572"
STS 1173..1318
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="RH12295"
/db_xref="UniSTS:58576"
variation 1250
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:112509046"
variation 1260
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="c"
/db_xref="dbSNP:187389510"
variation 1355
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:193160724"
variation 1361
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:138177732"
variation 1363
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:183755663"
variation 1422
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:73037892"
variation 1427
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:114584283"
variation 1441
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:115952869"
variation 1464
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="t"
/db_xref="dbSNP:72697779"
variation 1472
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:149549702"
variation 1484
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:370896138"
variation 1493
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:193135489"
variation 1502
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:147274411"
variation 1521
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace=""
/replace="t"
/db_xref="dbSNP:34678493"
variation 1598
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:140780938"
variation 1666
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:720612"
variation 1677
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:113574305"
variation 1707
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:147412044"
variation 1725
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="c"
/db_xref="dbSNP:183563193"
variation 1740..1741
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace=""
/replace="a"
/db_xref="dbSNP:35089441"
variation 1783
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:12072200"
variation 1830
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:186815046"
variation 1841
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:7414295"
variation 1911
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="c"
/db_xref="dbSNP:191636295"
variation 1924
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:184020611"
variation 1926
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="t"
/db_xref="dbSNP:189800509"
variation 1946
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:182056523"
variation 1959
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:185413057"
variation 2055
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:10125"
variation 2067
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:142735758"
variation 2094
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:114704696"
variation 2097..2101
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace=""
/replace="aagat"
/db_xref="dbSNP:66529257"
variation 2113
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:76940524"
variation 2127
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:35215126"
STS 2142..2977
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="MPZL1__7200"
/db_xref="UniSTS:466339"
variation 2188
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:3752606"
variation 2244
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:151009335"
variation 2286
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="g"
/replace="t"
/db_xref="dbSNP:140712114"
variation 2305
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:3088322"
variation 2400
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:143124803"
variation 2402
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:12745388"
variation 2537
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:74388383"
variation 2543
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="c"
/db_xref="dbSNP:146700702"
STS 2567..2641
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="D1S1803E"
/db_xref="UniSTS:150719"
STS 2656..2793
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="WI-12092"
/db_xref="UniSTS:34243"
STS 2657..2756
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="D1S1795E"
/db_xref="UniSTS:47740"
variation 2680
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:190565454"
variation 2685
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:7605"
STS 2767..3522
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="FLJ21047_2474"
/db_xref="UniSTS:463588"
STS 2817..2918
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="RH36145"
/db_xref="UniSTS:64757"
variation 2823
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:11807657"
variation 2924
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:181999887"
variation 2977
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:14212"
variation 3008..3011
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace=""
/replace="agtt"
/db_xref="dbSNP:374021239"
variation 3055
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:61995896"
variation 3142
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:140274317"
variation 3155
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:8917"
variation 3242
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:8623"
variation 3256
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:185284937"
STS 3266..3379
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/standard_name="A007A43"
/db_xref="UniSTS:35948"
variation 3298
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:145325991"
variation 3306
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:12316"
variation 3569
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="g"
/replace="t"
/db_xref="dbSNP:12071420"
variation 3593
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:189891170"
variation 3600
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:148979779"
variation 3713
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:113581119"
variation 3802
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:148155475"
variation 3829
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:141847648"
variation 3874
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:368920044"
variation 3926
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:10753763"
variation 3973
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="g"
/db_xref="dbSNP:76775177"
variation 4010
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="c"
/db_xref="dbSNP:371184482"
variation 4039
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:35065671"
variation 4095
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="t"
/db_xref="dbSNP:139012766"
variation 4125
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:181105938"
variation 4135
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:10753764"
variation 4151
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:186660095"
variation 4204
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:191445959"
variation 4210
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:183602418"
variation 4211
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:10800323"
variation 4292
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="a"
/replace="g"
/db_xref="dbSNP:188493549"
variation 4377
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:143146901"
variation 4474
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:192283907"
variation 4557
/gene="MPZL1"
/gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
/replace="c"
/replace="t"
/db_xref="dbSNP:147481157"
ORIGIN
agcgagggccggagtggggctgaggcttcggtgcagagctggagagccgcggctgggaccggagtggggagcgcggcgtggaggtgccacccggcgcgggtggcggagagatcagaagcctcttccccaagccgagccaacctcagcggggacccgggctcagggacgcggcggcggcggcggcgactgcagtggctggacgatggcagcgtccgccggagccggggcggtgattgcagccccagacagccggcgctggctgtggtcggtgctggcggcggcgcttgggctcttgacagctggagtatcagccttggaagtatatacgccaaaagaaatcttcgtggcaaatggtacacaagggaagctgacctgcaagttcaagtctactagtacgactggcgggttgacctcagtctcctggagcttccagccagagggggccgacactactgtgtcgggcccagtcatatatgcacagttagaccactccggcggacatcacagtgacaagattaacaagtcagagtctgtggtgtatgcggatatccgaaagaattaagagaatacctagaacatatcctcagcaagaaacaaaaccaaactggactctcgtgcagaaaatgtagcccattaccacatgtagccttggagacccaggcaaggacaagtacacgtgtactcacagagggagagaaagatgtgtacaaaggatatgtataaatattctatttagtcatcctgatatgaggagccagtgttgcatgatgaaaagatggtatgattctacatatgtacccattgtcttgctgtttttgtactttcttttcaggtcatttacaattgggagatttcagaaacattcctttcaccatcatttagaaatggtttgccttaatggagacaatagcagatcctgtagtatttccagtagacatggccttttaatctaagggcttaagactgattagtcttagcatttactgtagttggaggatggagatgctatgatggaagcatacccagggtggcctttagcacagtatcagtaccatttatttgtctgccgcttttaaaaaatacccattggctatgccacttgaaaacaatttgagaagtttttttgaagtttttctcactaaaatatggggcaattgttagccttacatgttgtgtagacttactttaagtttgcacccttgaaatgtgtcatatcaatttctggattcataatagcaagattagcaaaggataaatgccgaaggtcacttcattctggacacagttggatcaatactgattaagtagaaaatccaagctttgcttgagaacttttgtaacgtggagagtaaaaagtatcggttttattctttgctgatgtcctttctgcttgaaataacagtcaccatacagctaaaggagaggagtttctttccttctaagtaggcagaaatggtatcattatgttgccgctctccaatctcccagagctcgctctctagagaatcaccttctttcgcttttttttttttttttgaggtagagtctcactatgttgcccagactagccttgaactcttgggctcaagtgattctccctcctcagcctcccgagtagctggaacgaactatagttgcaccactgcagctggcaagaatcaccttctttataaagcgtcagtcatgcttccagcaagaggcagcatcagtcatggctttataacagcttcatggtgcctcaaagactgttgaggttaatgagagcctagattagacagtttggctgtccttccctaaaacttgttttctcctattcactactccccaccgcacttaaaatctatgagtttttactttttactgggaatggaaagtgtggtgaagatcattcaacacttatgttgtcatttctcccattttctgaatttttttttaaatttccccccttttaaaattgttcgaaagcccacagttatggaaagaattactgtctagatggtctgcagaacgtgtttggggtgagtgggagtgaggggcaatgttactttttctccctgtagtttggagtccattatgagctgctgctttttcttctcatcttgtcatcttctggggatgtttgaaggctgagttccaacagaattcacaaagggaataaaacaggattgagattttgaggtgtgcacaaggtggtaagataaagggcatatgagcttcaaaactaatgctgttgcatacatgaagccttttgttttttgaggagctatttttgttattcttgtaacgctccaccttacatgccacatctgtgtgagtcaacagggatcaggtttggtcaccacacatgtctgaagctgggcagcgtctgctctgtgttctgtgtggaatggagaaaaaaacgcctgccctgctgccttccatgttcataggcccagcccaagagagtgacacacagtgctggccctgagacatttccacaaagtggtcaactctgccttgcatcctaaaactttttgggcatctattttgaaaactataggagcctttggaaggcctcttatgtttggaggggaagggtgttgagattgtcaccatccttcaagctgagactcctggtgagcctttgccaccatgaaaaccacatagctgaccagggctgtgcttgaggtacagaggacacacattgtagacaggcctgtgtcatgtttccttacagtcgttttttacagagaaaaggggcattgttttttcactgctttctcaacagttcctgtgaataaatgaaacatttcggagctccctgagagcaagagccttcacttcttcttgcggtgccgggaccatgtgttggtgaagctggtgctgtgggggccactcactcgaatgacacctggaggcctgttcctcccttaccactcccttccccagcccgacttcttggcctcctgcccaaccagacacctcaaactctgtcagtgccctggcattctggcagagaatcctcaccagttctcaccaaccttccccccaggcaagggcagctgccagcatggtgctctgccaggacaggtttccctgaaggaagctgctcacactgagatgagcctctcagggcaggacctcttcccaagccctgcacacccacccctgcagcccttttggctccccttttccctgtgcctcagcactcctttcctggttgcagataacgaactaaggttgcctaaagggcagatctgccctctccatgtcttcgtcctggcaaacagggtcgtcttaaaattatgcgctaattctgtatgggagcactcaaaaggcattacttagagattgaaatttcaaactatctctagtttttcaatggaaatatatcagctagggaaaaaccatcaagctcattattattttttgatcttcagttgtatttttgtgaatattttaatacatctttttcaatttctgaattgtgttgtgtgctcattttgaccagaatagaaaaagagatatgcctttcactcatatcattccagctacacctgccttcttttcttcaaaaatgccgtccgtgtgcctgcttctgggcctttgcacatgctgttccctgggcctgaagcatgccttctgccaatattcctgtggtttgctctctgacttcctttaagcctctgctcaaatgttacctcctcagggagaccttctgtgatatataaaagagcaagccccccaccccaccgcctcagccttcctggccccctcagttctgctctagttactctatttctctccctctttcccagtacacacttgtctgttctcccgcattagaacatagttaacaagagaccagaaccttgctgttttgttcactgctccgtctgcagtaaagggaacagcacctggcacttagctgctcaatacatgttacgtggatggatgagtaggtggaagcattcatccattcagcaacctacactgagaacaatcctgtgccaagcactgtgctaagcataaggaaacaaaacaagacaaagctcctcaaggagcttgccacagggtggaggtgacaggtgacatgaatggaagtaactagtagttaccaaatacttggtgtgagccaggcactttgcatttctttctctattatttctgtgagttaacagtaattgtactaatcttaatcccattgtttgaaagattatatggcttacccagggccacttagctaataaaggaacagagaagaggggctgggcctggggccgctgtttgatccacagccttgttcctaaccactatgccctgtggcctctcacaccaaaaggaagtaccaaactgcttccttactcaaataaatgtgctgaaatgcagttgcagttttctcccagtcccttaggagctggttagagagtcccttaggaacttgagagggtagtgtagtctaggtggtaggcacagatgtctgagagctttaacctcagtctggaagacaatgtggtgacttaatttgttgagaactatgttacaaataatgtgttactaataaaacattgaggcttcgcaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:9019 -> Molecular function: GO:0005198 [structural molecule activity] evidence: TAS
GeneID:9019 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:9019 -> Biological process: GO:0007169 [transmembrane receptor protein tyrosine kinase signaling pathway] evidence: TAS
GeneID:9019 -> Biological process: GO:0007267 [cell-cell signaling] evidence: TAS
GeneID:9019 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.