Home |
Help |
Advanced search
2024-04-20 15:14:54, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001130047 3914 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens tubulin folding cofactor E-like (TBCEL), transcript
variant 2, mRNA.
ACCESSION NM_001130047
VERSION NM_001130047.1 GI:194239700
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3914)
AUTHORS Sellin,M.E., Holmfeldt,P., Stenmark,S. and Gullberg,M.
TITLE Op18/Stathmin counteracts the activity of overexpressed
tubulin-disrupting proteins in a human leukemia cell line
JOURNAL Exp. Cell Res. 314 (6), 1367-1377 (2008)
PUBMED 18262179
REMARK GeneRIF: Depletion of Op18 by means of RNA interference increased
the susceptibility of tubulin to TBCE or E-like mediated
disruption, while overexpressed Op18 exerted a tubulin-protective
effect.
REFERENCE 2 (bases 1 to 3914)
AUTHORS Bartolini,F., Tian,G., Piehl,M., Cassimeris,L., Lewis,S.A. and
Cowan,N.J.
TITLE Identification of a novel tubulin-destabilizing protein related to
the chaperone cofactor E
JOURNAL J. Cell. Sci. 118 (PT 6), 1197-1207 (2005)
PUBMED 15728251
REMARK GeneRIF: Leucine rich repeat containing 35 (E-like) is a novel
regulator of tubulin stability with overexpression causing
depolymerization of microtubules and suppression resulting in an
increase in the number of stable microtubules.
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AK313324.1, BC020501.1, DN602255.1, AI128257.1 and BX091943.1.
Transcript Variant: This variant (2) differs in the 5' UTR,
compared to variant 1. Variants 1 and 2 encode the same protein.
##Evidence-Data-START##
Transcript exon combination :: AK313324.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025098 [ECO:0000348]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-569 AK313324.1 23-591
570-2772 BC020501.1 606-2808
2773-3228 DN602255.1 355-810
3229-3496 AI128257.1 40-307 c
3497-3914 BX091943.1 1-418 c
FEATURES Location/Qualifiers
source 1..3914
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="11"
/map="11q23.3"
gene 1..3914
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/note="tubulin folding cofactor E-like"
/db_xref="GeneID:219899"
/db_xref="HGNC:28115"
/db_xref="MIM:610451"
exon 1..61
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/inference="alignment:Splign:1.39.8"
variation 28
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="t"
/db_xref="dbSNP:370834296"
exon 62..211
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/inference="alignment:Splign:1.39.8"
misc_feature 67..69
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/note="upstream in-frame stop codon"
CDS 79..1353
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/note="catastrophin; leucine rich repeat containing 35;
tubulin-specific chaperone e-like; E-like; leucine-rich
repeat-containing protein 35"
/codon_start=1
/product="tubulin-specific chaperone cofactor E-like
protein"
/protein_id="NP_001123519.1"
/db_xref="GI:194239701"
/db_xref="CCDS:CCDS31692.1"
/db_xref="GeneID:219899"
/db_xref="HGNC:28115"
/db_xref="MIM:610451"
/translation="
MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVESKTK
"
misc_feature 295..372
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
Region: LRR 1"
misc_feature 373..447
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
Region: LRR 2"
misc_feature 448..519
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
Region: LRR 3"
misc_feature 526..594
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
Region: LRR 4"
misc_feature 595..669
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
Region: LRR 5"
misc_feature 598..729
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/note="Leucine Rich repeats (2 copies); Region: LRR_4;
pfam12799"
/db_xref="CDD:205079"
misc_feature 673..750
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
Region: LRR 6"
misc_feature 754..828
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
Region: LRR 7"
misc_feature 1111..1335
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/note="Ubiquitin-like proteins; Region: UBQ; cl00155"
/db_xref="CDD:212176"
misc_feature order(1183..1185,1228..1230)
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/note="charged pocket; other site"
/db_xref="CDD:176352"
misc_feature 1234..1245
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/note="hydrophobic patch; other site"
/db_xref="CDD:176352"
variation 126
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:372493054"
variation 152
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="g"
/db_xref="dbSNP:138695287"
variation 162
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:114354179"
variation 166
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:376097465"
variation 177
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:150702205"
variation 185
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:185489274"
exon 212..351
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/inference="alignment:Splign:1.39.8"
variation 229
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:144833842"
variation 300
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:202229726"
exon 352..533
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/inference="alignment:Splign:1.39.8"
variation 352
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:376267533"
variation 479
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:377422079"
variation 513
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="g"
/replace="t"
/db_xref="dbSNP:140003630"
variation 514
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="t"
/db_xref="dbSNP:78944388"
variation 529
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:370948390"
exon 534..790
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/inference="alignment:Splign:1.39.8"
variation 620
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="t"
/db_xref="dbSNP:76061220"
variation 621
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:374778286"
variation 680
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:112262968"
variation 694
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:368110919"
variation 725
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="c"
/db_xref="dbSNP:370713023"
variation 748
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:373756527"
variation 773
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:113070356"
exon 791..917
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/inference="alignment:Splign:1.39.8"
variation 798
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:368859055"
variation 810
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:368689002"
variation 811
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:372851892"
variation 888
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:35380371"
variation 909
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:375999211"
exon 918..1034
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/inference="alignment:Splign:1.39.8"
variation 967
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:377427847"
variation 1018
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:146743853"
exon 1035..3904
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/inference="alignment:Splign:1.39.8"
variation 1107
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:368786975"
variation 1128
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:372272358"
variation 1132
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:139578794"
variation 1153
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:144345151"
variation 1176
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:146540306"
variation 1208
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:375282149"
variation 1209
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:140041201"
variation 1248
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:142279664"
variation 1291
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:373338413"
variation 1296
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:151214090"
variation 1432
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:11602226"
variation 1771
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="c"
/db_xref="dbSNP:112522932"
variation 1805
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:187013426"
variation 1821
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:192223056"
variation 1838..1839
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace=""
/replace="t"
/db_xref="dbSNP:376175003"
variation 1838
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:78898111"
variation 1838
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="gt"
/db_xref="dbSNP:374037889"
variation 1893..1894
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace=""
/replace="a"
/db_xref="dbSNP:35880364"
variation 2056
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace=""
/replace="a"
/db_xref="dbSNP:35274310"
variation 2065
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:368819132"
variation 2233
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:182842834"
variation 2249
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="g"
/replace="t"
/db_xref="dbSNP:151150784"
variation 2294
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="t"
/db_xref="dbSNP:188225607"
variation 2338
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:193272452"
variation 2349
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:7109612"
variation 2478
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:185388669"
variation 2505
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:369691016"
variation 2586
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:1063101"
variation 2610
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:111981178"
variation 2716
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="c"
/db_xref="dbSNP:140115272"
variation 2773
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:11218139"
variation 2922
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="g"
/replace="t"
/db_xref="dbSNP:189501439"
variation 3011
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="t"
/db_xref="dbSNP:17124764"
variation 3131
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:114126817"
variation 3143
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:111781066"
variation 3179
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="t"
/db_xref="dbSNP:112596169"
variation 3184
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:377402403"
variation 3228
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:137987759"
variation 3254
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace=""
/replace="t"
/db_xref="dbSNP:147288817"
variation 3268
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace=""
/replace="a"
/db_xref="dbSNP:35834454"
variation 3348
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:2298491"
variation 3506
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:191396363"
variation 3602
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:75050717"
variation 3699..3701
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace=""
/replace="aat"
/db_xref="dbSNP:370560199"
variation 3707
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="c"
/db_xref="dbSNP:184340231"
variation 3735
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:111848290"
variation 3805
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:188593117"
variation 3852
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:367758300"
ORIGIN
ggaaagctgcttccgggtcaatgcaggacactgggctccggcggccagagtgggggactagcattttaagaaagaaagatggatcaacctagtggaagaagtttcatgcaagtattatgtgaaaaatatagtcctgaaaattttccttatcgccgtggcccggggatgggagtccatgtcccagccacacctcagggctctcctatgaaagatcgcctcaacctcccaagtgtactagtgttgaacagctgtggaataacctgtgcaggagatgaaaaagaaattgctgctttctgcgctcatgtgtcggaactagatctttctgacaacaaactcgaagactggcatgaggtcagtaaaattgtgtcaaatgttcctcagttggagtttctaaacctgagttccaaccctctgaatttgtcggttttagaaagaacatgtgctgggtccttctctggggttcgcaaacttgtcctcaacaacagcaaagcttcttgggagacggtccacatgatactacaggagttaccagatttggaggagctcttcctgtgccttaatgactatgaaacagtgtcttgtccttctatttgctgtcattctcttaagctactacatataacagacaataacctccaagactggactgaaatacgaaagttaggagttatgtttccttcactggataccctcgtcctggccaacaatcatttgaatgctattgaggagcctgatgattcattggccaggttgtttcctaatcttcgatccatcagcctccacaagtcaggtttgcagtcctgggaagacattgataaactaaattcatttcccaaactggaagaagtgagattgttaggaattcctcttctgcagccatataccaccgaggagcgaaggaaattggtaatagccagattgccatcagtttccaaacttaatggcagcgttgttactgatggtgaacgagaagattctgagagattttttattcgttactatgtggatgttccacaggaagaagtgccattcaggtatcatgaactgatcactaaatatgggaagttggagcctttggcagaagtggacctaagaccccagagcagtgcaaaagtagaagtccactttaacgatcaggtggaagaaatgagcattcgtctggaccaaacagtggcagaactaaagaaacagttaaaaactctagtacaattacccacaagcaacatgcttctctactattttgaccatgaagcaccctttggcccagaggaaatgaagtacagctctcgggcattgcattcctttggcattagggatggagataaaatttacgtggaatccaaaacaaaataacctctaccagccttgtgaaaaacatacacataaggacttgttgcagggcatttgtttttaatgtggttttctttaggagggagaggttgtttttgttttgttttgttctgtttaggtttgggaaggattttgtatatttttccccctggagtgagtaggggccatttttgggtgttttctaccacagattgatttggctcagccagcggaattggccacatttccagtgtatgtgccctctctaaggaaagatgacaaagaaatcaccgacttcttactgtgttcactgggatttgcctgccacttggttatcattactgttgggtgaacctgtgaagataacatgaacactgtagccccttagaagggtctcatagagaatttaaacagggtgacaaggaatcttcacaggaagggccagaacttctctctcccagttcttccttccgctaccctccctccttggcttttttggttcagttccatttttttttcattttgacatgtggtttacctaatagttttgttctgttcataattcttatttctcaacctgggtgatttttttgttctcatttctcccttttgaaataattgaaagtgttttaagcatttttaacctgattctaatctcaggtacgcagtaagaagctataactctgttagaacctcgaagagtagatgtagaatgaaaactccaggaaaacttgcagttattctggaagcaccggcagaacagtctgatctctttgtatgttactaactcacttttaatgtccctgtacattatgtcagccattactttcataacatgaaatatgtcagattccagagttcttttatttttgcttattgaatgtatttcctcatatctttctttttcattactttaaactattgggaattgaggcctgacttcataaataattcaatagagtcctggatacgtgcaccaggagagttgagaattagctcataaactatctgtggtgtgtgtggggaatgaagttgggggatgtgggggaagagcttatgactttcccacctgtgtcatccattggaagcccttgctcttgcactttgcattaaaagtgggaaacattaatcaaagggagattttattcccaggttttccctgggactttgtgatatcataattgaacagttcttttgttttacatttcaatttagttgcctcatagaagtataactgcccaatctatgagtaaagtgtaagtgtcaaaactttacaattgcctccaagtcatattttttgcagaagcacatttaaagcacttttctgtaaaagctagttccttacctgcttggaaatctttttgtttgttcttctattcctttgttaatcagatgtaatccctttctttaatgtgtatttttcttggtccaccatgtttacagatgggagacttgagagatacttagcataactggggcagaaagtgtgtaagtgaagtatttttcaaagaatgcagttattatctgattgcatttgaccttttgacctttgttacataattctacccctcctacaaatttaatttttttatgaaatttttaggtgacttgtaaattcttcatgtatgaggagttgtgtttattaatgctactttttaaattttcctgtgccatgtggcagatgtttattctcttaatgcacttcaggtttgctatctgtaaagcctttgacccaggcctactgagtcaaatctacattcagtgtaacattaaaggtggaaaccaaagggtttgagaaagacgaataaggcctattctccttctgctgcagactttatctttcaaaatcataaaaatgagcaatggagatccaggctgggtatagacaagaataattattttgcaaacacattttcctgacagatttttggaagtaggaaaaaagtatggcaacagtgtcatgaagattgaaactgtaggtgctttgtgtatgtatgcatgagtgcagatgagtttgagagagaaaaagtgtaattgagccctttgcttttgtcagcctgggaaacagatgcgttcttattttttgaagttgtgtgaccctggactgtcccacagcagaaggcagaacaaacacttatgttatgctttaatcataagtggaatggtcacaattaataagatattttatatatggcaaagttttatgaaatgcttttttactattagagacctgtttcttctgttattacagaacacagtgtttatcaactgcggacataattcttttattatacagttgcatgtaaagggagcttctcatttaattcagcggatgtgggtatttttagggcattgtaattgatggttttaataattgctgaataatttttgattaagagaaaaatgtaatacaattactggtctgagttacagaacagaagttaatgaaaaaggctatttgagcatgtgtacttatagattcatttgggtggctgagaaaagatgctgcttttgaaataaaattggtgctgtgtagacacttgtaaccaaaattatttttataacagaactaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:219899 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
GeneID:219899 -> Cellular component: GO:0005856 [cytoskeleton] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.