2024-03-28 20:20:46, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001040701 3009 bp mRNA linear PRI 15-JUN-2013 DEFINITION Homo sapiens fucosyltransferase 6 (alpha (1,3) fucosyltransferase) (FUT6), transcript variant 2, mRNA. ACCESSION NM_001040701 VERSION NM_001040701.1 GI:103472032 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 3009) AUTHORS He,M., Wu,C., Xu,J., Guo,H., Yang,H., Zhang,X., Sun,J., Yu,D., Zhou,L., Peng,T., He,Y., Gao,Y., Yuan,J., Deng,Q., Dai,X., Tan,A., Feng,Y., Zhang,H., Min,X., Yang,X., Zhu,J., Zhai,K., Chang,J., Qin,X., Tan,W., Hu,Y., Lang,M., Tao,S., Li,Y., Li,Y., Feng,J., Li,D., Kim,S.T., Zhang,S., Zhang,H., Zheng,S.L., Gui,L., Wang,Y., Wei,S., Wang,F., Fang,W., Liang,Y., Zhai,Y., Chen,W., Miao,X., Zhou,G., Hu,F.B., Lin,D., Mo,Z. and Wu,T. TITLE A genome wide association study of genetic loci that influence tumour biomarkers cancer antigen 19-9, carcinoembryonic antigen and alpha fetoprotein and their associations with cancer risk JOURNAL Gut (2013) In press PUBMED 23300138 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 3009) AUTHORS Lin,X., Lu,D., Gao,Y., Tao,S., Yang,X., Feng,J., Tan,A., Zhang,H., Hu,Y., Qin,X., Kim,S.T., Peng,T., Li,L., Mo,L., Zhang,S., Trent,J.M., Mo,Z., Zheng,S.L., Xu,J. and Sun,J. TITLE Genome-wide association study identifies novel loci associated with serum level of vitamin B12 in Chinese men JOURNAL Hum. Mol. Genet. 21 (11), 2610-2617 (2012) PUBMED 22367966 REFERENCE 3 (bases 1 to 3009) AUTHORS Guo,Q., Guo,B., Wang,Y., Wu,J., Jiang,W., Zhao,S., Qiao,S. and Wu,Y. TITLE Functional analysis of alpha1,3/4-fucosyltransferase VI in human hepatocellular carcinoma cells JOURNAL Biochem. Biophys. Res. Commun. 417 (1), 311-317 (2012) PUBMED 22155250 REMARK GeneRIF: these results suggest that FUT6 plays an important role in hepatocellular carcinoma growth by regulating the PI3K/Akt signaling pathway. REFERENCE 4 (bases 1 to 3009) AUTHORS Trinchera,M., Malagolini,N., Chiricolo,M., Santini,D., Minni,F., Caretti,A. and Dall'olio,F. TITLE The biosynthesis of the selectin-ligand sialyl Lewis x in colorectal cancer tissues is regulated by fucosyltransferase VI and can be inhibited by an RNA interference-based approach JOURNAL Int. J. Biochem. Cell Biol. 43 (1), 130-139 (2011) PUBMED 20965272 REMARK GeneRIF: The biosynthesis of the selectin-ligand sialyl Lewis x in colorectal cancer tissues is regulated by fucosyltransferase VI and can be inhibited by an RNA interference-based approach. Erratum:[Int J Biochem Cell Biol. 2011 Nov;43(11):1649-50] REFERENCE 5 (bases 1 to 3009) AUTHORS Lauc,G., Essafi,A., Huffman,J.E., Hayward,C., Knezevic,A., Kattla,J.J., Polasek,O., Gornik,O., Vitart,V., Abrahams,J.L., Pucic,M., Novokmet,M., Redzic,I., Campbell,S., Wild,S.H., Borovecki,F., Wang,W., Kolcic,I., Zgaga,L., Gyllensten,U., Wilson,J.F., Wright,A.F., Hastie,N.D., Campbell,H., Rudd,P.M. and Rudan,I. TITLE Genomics meets glycomics-the first GWAS study of human N-Glycome identifies HNF1alpha as a master regulator of plasma protein fucosylation JOURNAL PLoS Genet. 6 (12), E1001256 (2010) PUBMED 21203500 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 3009) AUTHORS Cameron,H.S., Szczepaniak,D. and Weston,B.W. TITLE Expression of human chromosome 19p alpha(1,3)-fucosyltransferase genes in normal tissues. Alternative splicing, polyadenylation, and isoforms JOURNAL J. Biol. Chem. 270 (34), 20112-20122 (1995) PUBMED 7650030 REFERENCE 7 (bases 1 to 3009) AUTHORS McCurley,R.S., Recinos,A. III, Olsen,A.S., Gingrich,J.C., Szczepaniak,D., Cameron,H.S., Krauss,R. and Weston,B.W. TITLE Physical maps of human alpha (1,3)fucosyltransferase genes FUT3-FUT6 on chromosomes 19p13.3 and 11q21 JOURNAL Genomics 26 (1), 142-146 (1995) PUBMED 7782074 REFERENCE 8 (bases 1 to 3009) AUTHORS Reguigne-Arnould,I., Couillin,P., Mollicone,R., Faure,S., Fletcher,A., Kelly,R.J., Lowe,J.B. and Oriol,R. TITLE Relative positions of two clusters of human alpha-L-fucosyltransferases in 19q (FUT1-FUT2) and 19p (FUT6-FUT3-FUT5) within the microsatellite genetic map of chromosome 19 JOURNAL Cytogenet. Cell Genet. 71 (2), 158-162 (1995) PUBMED 7656588 REFERENCE 9 (bases 1 to 3009) AUTHORS Weston,B.W., Smith,P.L., Kelly,R.J. and Lowe,J.B. TITLE Molecular cloning of a fourth member of a human alpha (1,3)fucosyltransferase gene family. Multiple homologous sequences that determine expression of the Lewis x, sialyl Lewis x, and difucosyl sialyl Lewis x epitopes JOURNAL J. Biol. Chem. 267 (34), 24575-24584 (1992) PUBMED 1339443 REMARK Erratum:[J Biol Chem 1993 Aug 25;268(24):18398] REFERENCE 10 (bases 1 to 3009) AUTHORS Koszdin,K.L. and Bowen,B.R. TITLE The cloning and expression of a human alpha-1,3 fucosyltransferase capable of forming the E-selectin ligand JOURNAL Biochem. Biophys. Res. Commun. 187 (1), 152-157 (1992) PUBMED 1520296 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DA622182.1, DA628976.1, BC061700.1 and AC024592.5. Summary: The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]. Transcript Variant: This variant (2) differs in the 5' UTR compared to variant 1. Variants 1 and 2 both encode the same protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC061700.1, U27336.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025088 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-91 DA622182.1 2-92 92-130 DA628976.1 87-125 131-1135 BC061700.1 121-1125 1136-3009 AC024592.5 10240-12113 c FEATURES Location/Qualifiers source 1..3009 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="19" /map="19p13.3" gene 1..3009 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /note="fucosyltransferase 6 (alpha (1,3) fucosyltransferase)" /db_xref="GeneID:2528" /db_xref="HGNC:4017" /db_xref="MIM:136836" exon 1..1055 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /inference="alignment:Splign:1.39.8" STS 944..2237 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /db_xref="UniSTS:481220" exon 1056..3009 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /inference="alignment:Splign:1.39.8" misc_feature 1062..1064 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /note="upstream in-frame stop codon" CDS 1068..2147 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /EC_number="2.4.1.65" /note="galactoside 3-L-fucosyltransferase; fucosyltransferase VI" /codon_start=1 /product="alpha-(1,3)-fucosyltransferase" /protein_id="NP_001035791.1" /db_xref="GI:103472033" /db_xref="CCDS:CCDS12152.1" /db_xref="GeneID:2528" /db_xref="HGNC:4017" /db_xref="MIM:136836" /translation="
MDPLGPAKPQWSWRCCLTTLLFQLLMAVCFFSYLRVSQDDPTVYPNGSRFPDSTGTPAHSIPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPSHCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT
" misc_feature 1104..2141 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /note="Glycosyltransferase family 10 (fucosyltransferase); Region: Glyco_transf_10; pfam00852" /db_xref="CDD:144445" misc_feature 1110..1169 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P51993.1); transmembrane region" variation 1437 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /replace="c" /replace="t" /db_xref="dbSNP:778805" STS 1517..2234 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /standard_name="FUT6_V46" /db_xref="UniSTS:277258" variation 1666 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /replace="a" /replace="g" /db_xref="dbSNP:2879401" variation 1670 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /replace="a" /replace="g" /db_xref="dbSNP:4041473" variation 1671 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /replace="a" /replace="g" /db_xref="dbSNP:3964631" variation 1709 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /replace="c" /replace="t" /db_xref="dbSNP:364587" variation 1755 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /replace="a" /replace="c" /db_xref="dbSNP:364637" variation 1760 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /replace="a" /replace="g" /db_xref="dbSNP:443907" STS 2174..2404 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /standard_name="RH80293" /db_xref="UniSTS:85240" STS 2178..2401 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /standard_name="SGC35572" /db_xref="UniSTS:9344" variation 2717 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /replace="a" /replace="g" /db_xref="dbSNP:778806" STS 2754..2856 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /standard_name="D11S3114" /db_xref="UniSTS:152207" STS 2837..2925 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /standard_name="D8S2279" /db_xref="UniSTS:473907" variation 2867 /gene="FUT6" /gene_synonym="FCT3A; FT1A; Fuc-TVI; FucT-VI" /replace="c" /replace="t" /db_xref="dbSNP:778807" ORIGIN
aaaaccagtattccagatcatttctctccattccaggaagtttgcatagctccctggacttctgctttgcactgccctgcaggagtgggtggggaaaggaagtggctttgaggcacacagaggggcttgttgaggccaccggaggaagcttctgccaccaatatgggacctgtgcccagcctaccagaagagagcatctgaaaacatgtatcgacatggtaacccctctgcttgaagcctcacatggctccctattgccttggtgctgaacaccctatggctgaccgtggcccagcctctgcaacagctctgcctcctctccagtggtgaagacccagcctgctgagactcctcctgcagttcctcaacatgcctgcatttctgctgcctcagggcctttgcgaaggttgttccttgtaactggaatgcccttccatcccttttttattcaaaaggctgcaattttaattgaagaaagttcccttccaaggttcatgagttgcctgacttgcccaccggtttcctgcaagatcccttggcctggcacttagtgctcaggaaatatttggtgatgggccaactgagtgagaaggtgggatctggtgggaaggaaagcggaaaggtagaaattctgctcacttcctcattcccacctcccaaggaacccctggtgtccctgtggaacccgctttgggaaccggtggttcaggtcagccttttcactttgtactcaaagccacatcgcattgaagccacaggtggggcaaggtcatgcatgacctgagtctccaaatcccttcaccctgtttggttctgcaacggggattaggggagccccacgatttgttttcaaaggatgtccgggctccaggacaggatgccctgggtcacctgatgacaggtgtggtggttggaaagggcctggtttcagctccgggtacacttcctccttccttctgctgcgtggtgtggcctcttccacgtcctcagaatccagctgttactccgtccgcggcctctcagctctagggccctctgcacactggcccccccagatactctgacccatggatcccctgggcccggccaagccacagtggtcgtggcgctgctgtctgaccacgctgctgtttcagctgctgatggctgtgtgtttcttctcctatctgcgtgtgtctcaagacgatcccactgtgtaccctaatgggtcccgcttcccagacagcacagggacccccgcccactccatccccctgatcctgctgtggacgtggccttttaacaaacccatagctctgccccgctgctcagagatggtgcctggcacggctgactgcaacatcactgccgaccgcaaggtgtatccacaggcagacgcggtcatcgtgcaccaccgagaggtcatgtacaaccccagtgcccagctcccacgctccccgaggcggcaggggcagcgatggatctggttcagcatggagtccccaagccactgctggcagctgaaagccatggacggatacttcaatctcaccatgtcctaccgcagcgactccgacatcttcacgccctacggctggctggagccgtggtccggccagcctgcccacccaccgctcaacctctcggccaagaccgagctggtggcctgggcagtgtccaactgggggccaaactccgccagggtgcgctactaccagagcctgcaggcccatctcaaggtggacgtgtacggacgctcccacaagcccctgccccagggaaccatgatggagacgctgtcccggtacaagttctatctggccttcgagaactccttgcaccccgactacatcaccgagaagctgtggaggaacgccctggaggcctgggccgtgcccgtggtgctgggccccagcagaagcaactacgagaggttcctgccacccgacgccttcatccacgtggacgacttccagagccccaaggacctggcccggtacctgcaggagctggacaaggaccacgcccgctacctgagctactttcgctggcgggagacgctgcggcctcgctccttcagctgggcactcgctttctgcaaggcctgctggaaactgcaggaggaatccaggtaccagacacgcggcatagcggcttggttcacctgagaggctggtgtggggcctgggctgccaggaacctcattttcctggggcctcacctgagtgggggcctcatctacctaaggactcgtttgcctgaagcttcacctgcctgaggactcacctgcctgggacggtcacctgttgcagcttcacctgcctggggattcacctacctgggtcctcactttcctggggcctcacctgctggagtcttcggtggccaggtatgtcccttacctgggatttcacatgctggcttccaggagcgtcccctgcggaagcctggcctgctggggatgtctcctggggactttgcctactggggacctcggctgttggggactttacctgctgggacctgctcccagagaccttccacactgaatctcacctgctaggagcctcacctgctggggacctcaccctggagggcactgggccctgggaactggcacccatggggccccacccatgagtgatggttctggctgatttgtttgtgatgttgttagccgcctgtgaggggtgcagagagataatcaccgcaccgtttccagatgtaatactgcaaagaaaaccgatgatgaggccgggtgcggtggctcacacctgtaatcccagcactttgggaggccgaggcaggcggatcacaaggtcaggagatcgagaccatcctggccaatatggtgaaacccgtctctactaaaaatacaaaaatttgccgggcgtggtggtgcatgcctgtaatcccagctacttgggaagctgaggcaggagaatcgcttgaaccagagagtcggaggttgcagtaagccgagatcgcgccactgcactccagcctggcgacagagcgagactctgtctc
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:2528 -> Molecular function: GO:0008417 [fucosyltransferase activity] evidence: TAS GeneID:2528 -> Molecular function: GO:0017060 [3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity] evidence: IEA GeneID:2528 -> Molecular function: GO:0046920 [alpha-(1->3)-fucosyltransferase activity] evidence: TAS GeneID:2528 -> Biological process: GO:0006486 [protein glycosylation] evidence: IEA GeneID:2528 -> Biological process: GO:0006486 [protein glycosylation] evidence: TAS GeneID:2528 -> Biological process: GO:0036065 [fucosylation] evidence: TAS GeneID:2528 -> Biological process: GO:0042355 [L-fucose catabolic process] evidence: NAS GeneID:2528 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: TAS GeneID:2528 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA GeneID:2528 -> Cellular component: GO:0032580 [Golgi cisterna membrane] evidence: IEA ANNOTATIONS from NCBI Entrez Gene (20130726): NP_001035791 -> EC 2.4.1.65
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.