2024-04-19 03:27:13, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001012513 844 bp mRNA linear PRI 30-MAY-2013 DEFINITION Homo sapiens gastrin-releasing peptide (GRP), transcript variant 3, mRNA. ACCESSION NM_001012513 VERSION NM_001012513.1 GI:60498998 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 844) AUTHORS Nordlund,M.S., Stieber,P., Brustugun,O.T., Warren,D.J. and Paus,E. TITLE Characteristics and clinical validity of two immunoassays for ProGRP JOURNAL Tumour Biol. 33 (4), 1105-1113 (2012) PUBMED 22399443 REMARK GeneRIF: Data indicate that progastrin-releasing peptide (proGRP) assays with both time-resolved immunofluorometric assay (TR-IFMA) and Advanced Life Science Institute (ALSI) ELISA showed good clinical validity. REFERENCE 2 (bases 1 to 844) AUTHORS Ono,A., Naito,T., Ito,I., Watanabe,R., Shukuya,T., Kenmotsu,H., Tsuya,A., Nakamura,Y., Murakami,H., Kaira,K., Takahashi,T., Kameya,T., Nakajima,T., Endo,M. and Yamamoto,N. TITLE Correlations between serial pro-gastrin-releasing peptide and neuron-specific enolase levels, and the radiological response to treatment and survival of patients with small-cell lung cancer JOURNAL Lung Cancer 76 (3), 439-444 (2012) PUBMED 22300752 REMARK GeneRIF: Percent changes in serum ProGRP showed better correlation to the sum of the tumor diameters (SOD) and prognostic impact than that of NSE. REFERENCE 3 (bases 1 to 844) AUTHORS Tattersall,M., Cordeaux,Y., Charnock-Jones,D.S. and Smith,G.C. TITLE Expression of gastrin-releasing peptide is increased by prolonged stretch of human myometrium, and antagonists of its receptor inhibit contractility JOURNAL J. Physiol. (Lond.) 590 (PT 9), 2081-2093 (2012) PUBMED 22411014 REMARK GeneRIF: Tonic stretch of human myometrium increases contractility and stimulates the expression of a known smooth muscle stimulatory agonist, GRP. GRP receptor antagonists attenuate the effect of stretch. REFERENCE 4 (bases 1 to 844) AUTHORS Patel,O., Clyde,D., Chang,M., Nordlund,M.S., Steel,R., Kemp,B.E., Pritchard,D.M., Shulkes,A. and Baldwin,G.S. TITLE Pro-GRP-derived peptides are expressed in colorectal cancer cells and tumors and are biologically active in vivo JOURNAL Endocrinology 153 (3), 1082-1092 (2012) PUBMED 22202166 REMARK GeneRIF: nonamidated peptides derived from the C terminus of pro-GRP are expressed in significant quantities in colorectal cancer cell lines REFERENCE 5 (bases 1 to 844) AUTHORS Kim,S.Y., Kim,J.S., Hwang,S.H., Park,H.K., Lee,J.H., Lee,D.H., Hah,S.S. and Park do,Y. TITLE Progastrin-releasing peptide is a candidate marker for quality control in clinical sample processing and storage JOURNAL Am. J. Clin. Pathol. 137 (2), 277-282 (2012) PUBMED 22261454 REMARK GeneRIF: Progastrin-releasing peptide cab be used as a marker for quality control in clinical sample processing and storage. REFERENCE 6 (bases 1 to 844) AUTHORS Baraniuk,J.N., Lundgren,J.D., Shelhamer,J.H. and Kaliner,M.A. TITLE Gastrin releasing peptide (GRP) binding sites in human bronchi JOURNAL Neuropeptides 21 (2), 81-84 (1992) PUBMED 1557184 REFERENCE 7 (bases 1 to 844) AUTHORS Naylor,S.L., Sakaguchi,A.Y., Spindel,E. and Chin,W.W. TITLE Human gastrin-releasing peptide gene is located on chromosome 18 JOURNAL Somat. Cell Mol. Genet. 13 (1), 87-91 (1987) PUBMED 3027902 REFERENCE 8 (bases 1 to 844) AUTHORS Lebacq-Verheyden,A.M., Bertness,V., Kirsch,I., Hollis,G.F., McBride,O.W. and Battey,J. TITLE Human gastrin-releasing peptide gene maps to chromosome band 18q21 JOURNAL Somat. Cell Mol. Genet. 13 (1), 81-86 (1987) PUBMED 3027901 REFERENCE 9 (bases 1 to 844) AUTHORS Sausville,E.A., Lebacq-Verheyden,A.M., Spindel,E.R., Cuttitta,F., Gazdar,A.F. and Battey,J.F. TITLE Expression of the gastrin-releasing peptide gene in human small cell lung cancer. Evidence for alternative processing resulting in three distinct mRNAs JOURNAL J. Biol. Chem. 261 (5), 2451-2457 (1986) PUBMED 3003116 REFERENCE 10 (bases 1 to 844) AUTHORS Spindel,E.R., Zilberberg,M.D., Habener,J.F. and Chin,W.W. TITLE Two prohormones for gastrin-releasing peptide are encoded by two mRNAs differing by 19 nucleotides JOURNAL Proc. Natl. Acad. Sci. U.S.A. 83 (1), 19-23 (1986) PUBMED 3001723 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BC004488.2 and CK903483.1. Summary: This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. Its preproprotein, following cleavage of a signal peptide, is further processed to produce either the 27 aa gastrin-releasing peptide or the 10 aa neuromedin C. These smaller peptides regulate numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation. These peptides are also likely to play a role in human cancers of the lung, colon, stomach, pancreas, breast, and prostate. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]. Transcript Variant: This variant (3) uses an alternate splice site in the coding region, which results in a frameshift and an early stop codon, compared to variant 1. It encodes isoform 3 which has a shorter and distinct C-terminus, compared to isoform 1. This variant has also been identified as 'splice isoform 2', 'pro-gastrin releasing peptide type 3', and 'gastrin-releasing peptide nirs variant 1'. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: CK903483.1, BI964898.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025088 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-237 BC004488.2 1-237 238-461 CK903483.1 234-457 462-844 BC004488.2 481-863 FEATURES Location/Qualifiers source 1..844 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="18" /map="18q21.1-q21.32" gene 1..844 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /note="gastrin-releasing peptide" /db_xref="GeneID:2922" /db_xref="HGNC:4605" /db_xref="MIM:137260" exon 1..237 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /inference="alignment:Splign:1.39.8" CDS 99..515 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /note="isoform 3 preproprotein is encoded by transcript variant 3; bombesin; neuromedin C; pre-progastrin releasing peptide; prepro-GRP" /codon_start=1 /product="gastrin-releasing peptide isoform 3 preproprotein" /protein_id="NP_001012531.1" /db_xref="GI:60498999" /db_xref="CCDS:CCDS45878.1" /db_xref="GeneID:2922" /db_xref="HGNC:4605" /db_xref="MIM:137260" /translation="
MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDLVDSLLQVLNVKEGTPS
" sig_peptide 99..167 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /inference="COORDINATES: ab initio prediction:SignalP:4.0" proprotein 168..512 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /product="gastrin-releasing peptide proprotein" mat_peptide 168..248 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /product="gastrin-releasing peptide" misc_feature 207..209 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /experiment="experimental evidence, no additional details recorded" /note="proteolytic cleavage site; modified site" /db_xref="HPRD:02667" misc_feature 213..215 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /experiment="experimental evidence, no additional details recorded" /note="proteolytic cleavage site; modified site" /db_xref="HPRD:02667" misc_feature 216..218 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /experiment="experimental evidence, no additional details recorded" /note="proteolytic cleavage site; modified site" /db_xref="HPRD:02667" misc_feature 219..260 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /note="Bombesin-like peptide; Region: Bombesin; pfam02044" /db_xref="CDD:110990" mat_peptide 219..248 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /product="neuromedin C" /exception="alternative processing" misc_feature 222..224 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /experiment="experimental evidence, no additional details recorded" /note="proteolytic cleavage site; modified site" /db_xref="HPRD:02666" misc_feature 225..227 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /experiment="experimental evidence, no additional details recorded" /note="proteolytic cleavage site; modified site" /db_xref="HPRD:02666" misc_feature 228..230 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /experiment="experimental evidence, no additional details recorded" /note="proteolytic cleavage site; modified site" /db_xref="HPRD:02666" misc_feature 231..233 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /experiment="experimental evidence, no additional details recorded" /note="proteolytic cleavage site; modified site" /db_xref="HPRD:02666" misc_feature 240..242 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /experiment="experimental evidence, no additional details recorded" /note="proteolytic cleavage site; modified site" /db_xref="HPRD:02666" misc_feature 246..248 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /experiment="experimental evidence, no additional details recorded" /note="Methionine amide; propagated from UniProtKB/Swiss-Prot (P07492.2); amidation site" variation 108 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="a" /replace="c" /db_xref="dbSNP:1062557" variation 116 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="c" /replace="t" /db_xref="dbSNP:372288358" variation 132 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="a" /replace="g" /db_xref="dbSNP:35957920" variation 149 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="a" /replace="g" /db_xref="dbSNP:1042431" exon 238..461 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /inference="alignment:Splign:1.39.8" variation 242 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="c" /replace="t" /db_xref="dbSNP:199962860" variation 247 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="c" /replace="t" /db_xref="dbSNP:368410424" variation 261 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="a" /replace="g" /db_xref="dbSNP:375754489" variation 278 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="c" /replace="t" /db_xref="dbSNP:146673900" variation 289 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="c" /replace="g" /db_xref="dbSNP:143274265" variation 318 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="g" /replace="t" /db_xref="dbSNP:374866055" variation 338 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="g" /replace="t" /db_xref="dbSNP:377146993" variation 361 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="c" /replace="t" /db_xref="dbSNP:368021851" variation 370 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="a" /replace="g" /db_xref="dbSNP:371397932" variation 407 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="a" /replace="c" /db_xref="dbSNP:375963114" variation 423 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="c" /replace="t" /db_xref="dbSNP:148328512" variation 427 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="c" /replace="t" /db_xref="dbSNP:200302824" variation 428 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="g" /replace="t" /db_xref="dbSNP:55796466" variation 461 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="c" /replace="t" /db_xref="dbSNP:15526" exon 462..829 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /inference="alignment:Splign:1.39.8" variation 466 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="c" /replace="t" /db_xref="dbSNP:200574825" variation 494..497 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="" /replace="gaag" /db_xref="dbSNP:149962068" variation 496 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="a" /replace="g" /db_xref="dbSNP:185933795" variation 535 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="g" /replace="t" /db_xref="dbSNP:376342645" STS 538..812 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /standard_name="D18S1265" /db_xref="UniSTS:68109" STS 560..804 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /standard_name="STS-K02054" /db_xref="UniSTS:9077" variation 564 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="c" /replace="t" /db_xref="dbSNP:369600106" variation 597 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="c" /replace="t" /db_xref="dbSNP:2742" variation 743 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="c" /replace="t" /db_xref="dbSNP:144426024" variation 750 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="a" /replace="t" /db_xref="dbSNP:1803673" variation 801 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="a" /replace="c" /db_xref="dbSNP:3180482" polyA_signal 803..808 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" variation 820 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" /replace="a" /replace="g" /db_xref="dbSNP:72956189" polyA_site 829 /gene="GRP" /gene_synonym="BN; GRP-10; preproGRP; proGRP" ORIGIN
ccagcggctgcggcggcggagctcctccgaggtccgggtcaccagtctctgctcttcccagcctctccggcgcgctccaagggcttcccgtcgggaccatgcgcggccgtgagctcccgctggtcctgctggcgctggtcctctgcctggcgccccgggggcgagcggtcccgctgcctgcgggcggagggaccgtgctgaccaagatgtacccgcgcggcaaccactgggcggtggggcacttaatggggaaaaagagcacaggggagtcttcttctgtttctgagagagggagcctgaagcagcagctgagagagtacatcaggtgggaagaagctgcaaggaatttgctgggtctcatagaagcaaaggagaacagaaaccaccagccacctcaacccaaggccctgggcaatcagcagccttcgtgggattcagaggatagcagcaacttcaaagatttggtagactctctgctccaggttctcaacgtgaaggaaggaacccccagctgaaccagcaatgataatgatggcctctctcaaaagagaaaaacaaaacccctaagagactgcgttctgcaagcatcagttctacggatcatcaacaagatttccttgtgcaaaatatttgactattctgtatctttcatccttgactaaattcgtgattttcaagcagcatcttctggtttaaacttgtttgctgtgaacaattgtcgaaaagagtcttccaattaatgcttttttatatctaggctacctgttggttagattcaaggccccgagctgttaccattcacaataaaagcttaaacacattgtccaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:2922 -> Molecular function: GO:0005102 [receptor binding] evidence: NAS GeneID:2922 -> Molecular function: GO:0005184 [neuropeptide hormone activity] evidence: IDA GeneID:2922 -> Biological process: GO:0007165 [signal transduction] evidence: NAS GeneID:2922 -> Biological process: GO:0007218 [neuropeptide signaling pathway] evidence: IDA GeneID:2922 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS GeneID:2922 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.