2024-04-20 21:31:14, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001009813 1977 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens Meis homeobox 3 (MEIS3), transcript variant 2, mRNA. ACCESSION NM_001009813 XM_085929 VERSION NM_001009813.2 GI:385137118 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1977) AUTHORS Hyman-Walsh,C., Bjerke,G.A. and Wotton,D. TITLE An autoinhibitory effect of the homothorax domain of Meis2 JOURNAL FEBS J. 277 (12), 2584-2597 (2010) PUBMED 20553494 REMARK GeneRIF: This work suggests that the transcriptional activity of all members of the Meis/Prep Hth protein family is subject to autoinhibition by their Hth domains, and that the Meis3.2 splice variant encodes a protein that bypasses this autoinhibitory effect. REFERENCE 2 (bases 1 to 1977) AUTHORS Shim,S., Kim,Y., Shin,J., Kim,J. and Park,S. TITLE Regulation of EphA8 gene expression by TALE homeobox transcription factors during development of the mesencephalon JOURNAL Mol. Cell. Biol. 27 (5), 1614-1630 (2007) PUBMED 17178831 REFERENCE 3 (bases 1 to 1977) AUTHORS Steelman,S., Moskow,J.J., Muzynski,K., North,C., Druck,T., Montgomery,J.C., Huebner,K., Daar,I.O. and Buchberg,A.M. TITLE Identification of a conserved family of Meis1-related homeobox genes JOURNAL Genome Res. 7 (2), 142-156 (1997) PUBMED 9049632 REFERENCE 4 (bases 1 to 1977) AUTHORS Nakamura,T., Jenkins,N.A. and Copeland,N.G. TITLE Identification of a new family of Pbx-related homeobox genes JOURNAL Oncogene 13 (10), 2235-2242 (1996) PUBMED 8950991 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CF993984.1, AL537583.3, BC069251.1 and DB545063.1. On Apr 21, 2012 this sequence version replaced gi:57863278. Transcript Variant: This variant (2) uses alternate in-frame acceptor splice sites at two internal exon junctions compared to variant 1, which results in a shorter isoform (2) missing two internal protein segments compared to isoform 1. ##Evidence-Data-START## Transcript exon combination :: BC069251.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025088 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-359 CF993984.1 27-385 360-378 AL537583.3 101-119 379-1971 BC069251.1 1-1593 1972-1977 DB545063.1 451-456 FEATURES Location/Qualifiers source 1..1977 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="19" /map="19q13.32" gene 1..1977 /gene="MEIS3" /gene_synonym="MRG2" /note="Meis homeobox 3" /db_xref="GeneID:56917" /db_xref="HGNC:29537" /db_xref="HPRD:14386" exon 1..459 /gene="MEIS3" /gene_synonym="MRG2" /inference="alignment:Splign:1.39.8" misc_feature 229..231 /gene="MEIS3" /gene_synonym="MRG2" /note="upstream in-frame stop codon" CDS 448..1524 /gene="MEIS3" /gene_synonym="MRG2" /note="isoform 2 is encoded by transcript variant 2; homeobox protein Meis3; meis1-related protein 2; Meis1, myeloid ecotropic viral integration site 1 homolog 3" /codon_start=1 /product="homeobox protein Meis3 isoform 2" /protein_id="NP_001009813.1" /db_xref="GI:57863279" /db_xref="CCDS:CCDS46132.1" /db_xref="GeneID:56917" /db_xref="HGNC:29537" /db_xref="HPRD:14386" /translation="
MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL
" misc_feature 1186..1353 /gene="MEIS3" /gene_synonym="MRG2" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:28970" misc_feature order(1186..1197,1201..1203,1261..1263,1279..1281, 1318..1320,1324..1329,1336..1341,1345..1353) /gene="MEIS3" /gene_synonym="MRG2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:28970" misc_feature order(1189..1191,1198..1200,1327..1329,1336..1341, 1348..1350) /gene="MEIS3" /gene_synonym="MRG2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:28970" exon 460..632 /gene="MEIS3" /gene_synonym="MRG2" /inference="alignment:Splign:1.39.8" exon 633..792 /gene="MEIS3" /gene_synonym="MRG2" /inference="alignment:Splign:1.39.8" exon 793..843 /gene="MEIS3" /gene_synonym="MRG2" /inference="alignment:Splign:1.39.8" exon 844..894 /gene="MEIS3" /gene_synonym="MRG2" /inference="alignment:Splign:1.39.8" exon 895..993 /gene="MEIS3" /gene_synonym="MRG2" /inference="alignment:Splign:1.39.8" exon 994..1105 /gene="MEIS3" /gene_synonym="MRG2" /inference="alignment:Splign:1.39.8" exon 1106..1254 /gene="MEIS3" /gene_synonym="MRG2" /inference="alignment:Splign:1.39.8" exon 1255..1331 /gene="MEIS3" /gene_synonym="MRG2" /inference="alignment:Splign:1.39.8" exon 1332..1390 /gene="MEIS3" /gene_synonym="MRG2" /inference="alignment:Splign:1.39.8" exon 1391..1474 /gene="MEIS3" /gene_synonym="MRG2" /inference="alignment:Splign:1.39.8" exon 1475..1541 /gene="MEIS3" /gene_synonym="MRG2" /inference="alignment:Splign:1.39.8" STS 1518..1756 /gene="MEIS3" /gene_synonym="MRG2" /standard_name="RH80845" /db_xref="UniSTS:91107" exon 1542..1977 /gene="MEIS3" /gene_synonym="MRG2" /inference="alignment:Splign:1.39.8" variation 1613 /gene="MEIS3" /gene_synonym="MRG2" /replace="c" /replace="t" /db_xref="dbSNP:14163" variation 1630 /gene="MEIS3" /gene_synonym="MRG2" /replace="c" /replace="t" /db_xref="dbSNP:11622" variation 1641 /gene="MEIS3" /gene_synonym="MRG2" /replace="c" /replace="t" /db_xref="dbSNP:12620" variation 1689 /gene="MEIS3" /gene_synonym="MRG2" /replace="c" /replace="t" /db_xref="dbSNP:1054120" variation 1803 /gene="MEIS3" /gene_synonym="MRG2" /replace="a" /replace="g" /db_xref="dbSNP:1054126" variation 1916 /gene="MEIS3" /gene_synonym="MRG2" /replace="c" /replace="t" /db_xref="dbSNP:1054128" polyA_site 1971 /gene="MEIS3" /gene_synonym="MRG2" ORIGIN
ggagagaccgggaacggggagcgcggctgccagcacccctgagccgccgccggaccctccgtcgccccgggccgccccccgccccctgcggtccccggtgtgtccgtctcgggacggttcgattccctccagagccggggaagggacggggggggcccagaggagggggcctcgggcgccccgcctgcgcctgctgcccccgccccggcggcgatgcgctcctggccgtgacccccgctgggggcgggggccggggtccatgcgcggagtccccacccggcccggcgcctgccgctgacggcggcgggggtgggggggcgcgcgcctggcctcctgcccaccccctggcgtcaacaccgcgggccgtcaggggctgcggccccgggctgcgccctcccccgcggccaggctctggagggacccaggagctgccgccggcctcagcccatggcccggaggtatgatgagctgccgcactacccaggcatcgtggatggccccgcagccctggctagcttcccagagacagtgcccgcagtaccagggccctatggcccgcaccggcctccccagcccctgcccccaggcttggacagcgacggcctgaagagggagaaggatgagatctatggacacccgctcttccccctcttggccctggtctttgagaaatgtgaactggctacatgctctccccgtgacggggccggagctgggctggggacaccccctggaggtgacgtctgctcctctgattccttcaacgaggacatcgctgcctttgccaagcaggttcgctctgagaggcccctcttctcctccaacccagaactggacaatctgatgatccaggccatccaggtgctgcggttccacctgctggagctggagaagggaaagatgcccatcgacctggtcatcgaggatcgggacggcggctgcagggaggacttcgaggactacccagcctcctgccccagcctcccagaccagaataatatgtggattcgagaccatgaggatagtgggtctgtacatttggggaccccaggtccatccagtgggggcctggcctcccagagtggggacaactccagtgaccaaggagacgggctggacaccagcgtggcctctcccagttctggtggagaagatgaggacttggaccaggagcgacggcgaaacaagaagagggggatcttccccaaggtggccaccaacatcatgcgagcctggttgttccagcacctctcgcacccgtacccctcggaggagcagaagaaacagctggcgcaggacacggggctcaccatcctgcaagtcaacaactggttcattaacgcccggagacgcatcgtgcaacctatgatcgatcaatccaaccgcacagggcagggtgcagccttcagcccagagggccagcccatcgggggctataccgagacgcagccacacgtggccgtccggcctccgggatcagtggggatgagtttgaacttggaaggagaatggcattatctatagaggctgatgcaggagagacccagcctccggctgtgacccccagcctcacacctgcctctggttcccgcctggtcctccagcttcaggaccccacctccaaaggcccctctgctcaatgcctacctccctagggccctgctgggacatgggggcctgagtgcccatccaagggctctcaaggacaccggcaaggcctccaggccctgagccccacttctgccttcacctctgcctgggacccgagctgggctcctgggccttggtccccagaagatggcggctagggcctcgccgccaggacagagaagggacggggtggctgggcagtcagggaaggagggtcgcccggatccgacattttggagagattccttcactctcctgtcccccctacctcccttctctaatttcttcttttttttaatgataaagtcttaaaaacacggagccacc
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:56917 -> Molecular function: GO:0001077 [RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription] evidence: IEA GeneID:56917 -> Molecular function: GO:0003682 [chromatin binding] evidence: IEA GeneID:56917 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IDA GeneID:56917 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IEA GeneID:56917 -> Biological process: GO:0051897 [positive regulation of protein kinase B signaling cascade] evidence: IEA GeneID:56917 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.