LOCUS       NM_001009813            1977 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens Meis homeobox 3 (MEIS3), transcript variant 2, mRNA.
ACCESSION   NM_001009813 XM_085929
VERSION     NM_001009813.2  GI:385137118
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1977)
  AUTHORS   Hyman-Walsh,C., Bjerke,G.A. and Wotton,D.
  TITLE     An autoinhibitory effect of the homothorax domain of Meis2
  JOURNAL   FEBS J. 277 (12), 2584-2597 (2010)
   PUBMED   20553494
  REMARK    GeneRIF: This work suggests that the transcriptional activity of
            all members of the Meis/Prep Hth protein family is subject to
            autoinhibition by their Hth domains, and that the Meis3.2 splice
            variant encodes a protein that bypasses this autoinhibitory effect.
REFERENCE   2  (bases 1 to 1977)
  AUTHORS   Shim,S., Kim,Y., Shin,J., Kim,J. and Park,S.
  TITLE     Regulation of EphA8 gene expression by TALE homeobox transcription
            factors during development of the mesencephalon
  JOURNAL   Mol. Cell. Biol. 27 (5), 1614-1630 (2007)
   PUBMED   17178831
REFERENCE   3  (bases 1 to 1977)
  AUTHORS   Steelman,S., Moskow,J.J., Muzynski,K., North,C., Druck,T.,
            Montgomery,J.C., Huebner,K., Daar,I.O. and Buchberg,A.M.
  TITLE     Identification of a conserved family of Meis1-related homeobox
            genes
  JOURNAL   Genome Res. 7 (2), 142-156 (1997)
   PUBMED   9049632
REFERENCE   4  (bases 1 to 1977)
  AUTHORS   Nakamura,T., Jenkins,N.A. and Copeland,N.G.
  TITLE     Identification of a new family of Pbx-related homeobox genes
  JOURNAL   Oncogene 13 (10), 2235-2242 (1996)
   PUBMED   8950991
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CF993984.1, AL537583.3, BC069251.1 and DB545063.1.
            On Apr 21, 2012 this sequence version replaced gi:57863278.
            
            Transcript Variant: This variant (2) uses alternate in-frame
            acceptor splice sites at two internal exon junctions compared to
            variant 1, which results in a shorter isoform (2) missing two
            internal protein segments compared to isoform 1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC069251.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025088 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-359               CF993984.1         27-385
            360-378             AL537583.3         101-119
            379-1971            BC069251.1         1-1593
            1972-1977           DB545063.1         451-456
FEATURES             Location/Qualifiers
     source          1..1977
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19q13.32"
     gene            1..1977
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /note="Meis homeobox 3"
                     /db_xref="GeneID:56917"
                     /db_xref="HGNC:29537"
                     /db_xref="HPRD:14386"
     exon            1..459
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    229..231
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /note="upstream in-frame stop codon"
     CDS             448..1524
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /note="isoform 2 is encoded by transcript variant 2;
                     homeobox protein Meis3; meis1-related protein 2; Meis1,
                     myeloid ecotropic viral integration site 1 homolog 3"
                     /codon_start=1
                     /product="homeobox protein Meis3 isoform 2"
                     /protein_id="NP_001009813.1"
                     /db_xref="GI:57863279"
                     /db_xref="CCDS:CCDS46132.1"
                     /db_xref="GeneID:56917"
                     /db_xref="HGNC:29537"
                     /db_xref="HPRD:14386"
                     /translation="

MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL

"
     misc_feature    1186..1353
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(1186..1197,1201..1203,1261..1263,1279..1281,
                     1318..1320,1324..1329,1336..1341,1345..1353)
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(1189..1191,1198..1200,1327..1329,1336..1341,
                     1348..1350)
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     exon            460..632
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /inference="alignment:Splign:1.39.8"
     exon            633..792
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /inference="alignment:Splign:1.39.8"
     exon            793..843
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /inference="alignment:Splign:1.39.8"
     exon            844..894
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /inference="alignment:Splign:1.39.8"
     exon            895..993
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /inference="alignment:Splign:1.39.8"
     exon            994..1105
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /inference="alignment:Splign:1.39.8"
     exon            1106..1254
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /inference="alignment:Splign:1.39.8"
     exon            1255..1331
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /inference="alignment:Splign:1.39.8"
     exon            1332..1390
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /inference="alignment:Splign:1.39.8"
     exon            1391..1474
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /inference="alignment:Splign:1.39.8"
     exon            1475..1541
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /inference="alignment:Splign:1.39.8"
     STS             1518..1756
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /standard_name="RH80845"
                     /db_xref="UniSTS:91107"
     exon            1542..1977
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /inference="alignment:Splign:1.39.8"
     variation       1613
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:14163"
     variation       1630
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11622"
     variation       1641
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12620"
     variation       1689
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1054120"
     variation       1803
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1054126"
     variation       1916
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1054128"
     polyA_site      1971
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
ORIGIN      

ggagagaccgggaacggggagcgcggctgccagcacccctgagccgccgccggaccctccgtcgccccgggccgccccccgccccctgcggtccccggtgtgtccgtctcgggacggttcgattccctccagagccggggaagggacggggggggcccagaggagggggcctcgggcgccccgcctgcgcctgctgcccccgccccggcggcgatgcgctcctggccgtgacccccgctgggggcgggggccggggtccatgcgcggagtccccacccggcccggcgcctgccgctgacggcggcgggggtgggggggcgcgcgcctggcctcctgcccaccccctggcgtcaacaccgcgggccgtcaggggctgcggccccgggctgcgccctcccccgcggccaggctctggagggacccaggagctgccgccggcctcagcccatggcccggaggtatgatgagctgccgcactacccaggcatcgtggatggccccgcagccctggctagcttcccagagacagtgcccgcagtaccagggccctatggcccgcaccggcctccccagcccctgcccccaggcttggacagcgacggcctgaagagggagaaggatgagatctatggacacccgctcttccccctcttggccctggtctttgagaaatgtgaactggctacatgctctccccgtgacggggccggagctgggctggggacaccccctggaggtgacgtctgctcctctgattccttcaacgaggacatcgctgcctttgccaagcaggttcgctctgagaggcccctcttctcctccaacccagaactggacaatctgatgatccaggccatccaggtgctgcggttccacctgctggagctggagaagggaaagatgcccatcgacctggtcatcgaggatcgggacggcggctgcagggaggacttcgaggactacccagcctcctgccccagcctcccagaccagaataatatgtggattcgagaccatgaggatagtgggtctgtacatttggggaccccaggtccatccagtgggggcctggcctcccagagtggggacaactccagtgaccaaggagacgggctggacaccagcgtggcctctcccagttctggtggagaagatgaggacttggaccaggagcgacggcgaaacaagaagagggggatcttccccaaggtggccaccaacatcatgcgagcctggttgttccagcacctctcgcacccgtacccctcggaggagcagaagaaacagctggcgcaggacacggggctcaccatcctgcaagtcaacaactggttcattaacgcccggagacgcatcgtgcaacctatgatcgatcaatccaaccgcacagggcagggtgcagccttcagcccagagggccagcccatcgggggctataccgagacgcagccacacgtggccgtccggcctccgggatcagtggggatgagtttgaacttggaaggagaatggcattatctatagaggctgatgcaggagagacccagcctccggctgtgacccccagcctcacacctgcctctggttcccgcctggtcctccagcttcaggaccccacctccaaaggcccctctgctcaatgcctacctccctagggccctgctgggacatgggggcctgagtgcccatccaagggctctcaaggacaccggcaaggcctccaggccctgagccccacttctgccttcacctctgcctgggacccgagctgggctcctgggccttggtccccagaagatggcggctagggcctcgccgccaggacagagaagggacggggtggctgggcagtcagggaaggagggtcgcccggatccgacattttggagagattccttcactctcctgtcccccctacctcccttctctaatttcttcttttttttaatgataaagtcttaaaaacacggagccacc

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:56917 -> Molecular function: GO:0001077 [RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription] evidence: IEA
            GeneID:56917 -> Molecular function: GO:0003682 [chromatin binding] evidence: IEA
            GeneID:56917 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IDA
            GeneID:56917 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IEA
            GeneID:56917 -> Biological process: GO:0051897 [positive regulation of protein kinase B signaling cascade] evidence: IEA
            GeneID:56917 -> Cellular component: GO:0005634 [nucleus] evidence: IEA