LOCUS       NM_000307               1507 bp    mRNA    linear   PRI 27-MAR-2013
DEFINITION  Homo sapiens POU class 3 homeobox 4 (POU3F4), mRNA.
ACCESSION   NM_000307
VERSION     NM_000307.4  GI:433288479
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1507)
  AUTHORS   Choi,B.Y., Kim,D.H., Chung,T., Chang,M., Kim,E.H., Kim,A.R.,
            Seok,J., Chang,S.O., Bok,J., Kim,D., Oh,S.H. and Park,W.Y.
  TITLE     Destabilization and mislocalization of POU3F4 by C-terminal
            frameshift truncation and extension mutation
  JOURNAL   Hum. Mutat. 34 (2), 309-316 (2013)
   PUBMED   23076972
REFERENCE   2  (bases 1 to 1507)
  AUTHORS   Yuan,Y., Zhang,X., Huang,S., Zuo,L., Zhang,G., Song,Y., Wang,G.,
            Wang,H., Huang,D., Han,D. and Dai,P.
  TITLE     Common molecular etiologies are rare in nonsyndromic Tibetan
            Chinese patients with hearing impairment
  JOURNAL   PLoS ONE 7 (2), E30720 (2012)
   PUBMED   22389666
  REMARK    GeneRIF: Study found no mutations in GJB6 or POU3F4 in nonsyndromic
            Tibetan Chinese patients with hearing impairment.
REFERENCE   3  (bases 1 to 1507)
  AUTHORS   Song,M.H., Lee,K.Y., Choi,J.Y., Bok,J. and Kim,U.K.
  TITLE     Nonsyndromic X-linked hearing loss
  JOURNAL   Front Biosci (Elite Ed) 4, 924-933 (2012)
   PUBMED   22201925
  REMARK    Review article
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1507)
  AUTHORS   Schild,C., Prera,E., Lublinghoff,N., Arndt,S., Aschendorff,A. and
            Birkenhager,R.
  TITLE     Novel mutation in the homeobox domain of transcription factor
            POU3F4 associated with profound sensorineural hearing loss
  JOURNAL   Otol. Neurotol. 32 (4), 690-694 (2011)
   PUBMED   21555964
REFERENCE   5  (bases 1 to 1507)
  AUTHORS   Malik,K.F., Jaffe,H., Brady,J. and Young,W.S. III.
  TITLE     The class III POU factor Brn-4 interacts with other class III POU
            factors and the heterogeneous nuclear ribonucleoprotein U
  JOURNAL   Brain Res. Mol. Brain Res. 45 (1), 99-107 (1997)
   PUBMED   9105675
REFERENCE   6  (bases 1 to 1507)
  AUTHORS   Kandpal,G., Jacob,A.N. and Kandpal,R.P.
  TITLE     Transcribed sequences encoded in the region involved in contiguous
            deletion syndrome that comprises X-linked stapes fixation and
            deafness
  JOURNAL   Somat. Cell Mol. Genet. 22 (6), 511-517 (1996)
   PUBMED   9131020
REFERENCE   7  (bases 1 to 1507)
  AUTHORS   Engelkamp,D. and van Heyningen,V.
  TITLE     Transcription factors in disease
  JOURNAL   Curr. Opin. Genet. Dev. 6 (3), 334-342 (1996)
   PUBMED   8791518
  REMARK    Review article
REFERENCE   8  (bases 1 to 1507)
  AUTHORS   Bitner-Glindzicz,M., Turnpenny,P., Hoglund,P., Kaariainen,H.,
            Sankila,E.M., van der Maarel,S.M., de Kok,Y.J., Ropers,H.H.,
            Cremers,F.P., Pembrey,M. et al.
  TITLE     Further mutations in Brain 4 (POU3F4) clarify the phenotype in the
            X-linked deafness, DFN3
  JOURNAL   Hum. Mol. Genet. 4 (8), 1467-1469 (1995)
   PUBMED   7581392
REFERENCE   9  (bases 1 to 1507)
  AUTHORS   de Kok,Y.J., van der Maarel,S.M., Bitner-Glindzicz,M., Huber,I.,
            Monaco,A.P., Malcolm,S., Pembrey,M.E., Ropers,H.H. and Cremers,F.P.
  TITLE     Association between X-linked mixed deafness and mutations in the
            POU domain gene POU3F4
  JOURNAL   Science 267 (5198), 685-688 (1995)
   PUBMED   7839145
REFERENCE   10 (bases 1 to 1507)
  AUTHORS   Douville,P.J., Atanasoski,S., Tobler,A., Fontana,A. and Schwab,M.E.
  TITLE     The brain-specific POU-box gene Brn4 is a sex-linked transcription
            factor located on the human and mouse X chromosomes
  JOURNAL   Mamm. Genome 5 (3), 180-182 (1994)
   PUBMED   7911044
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AK314967.1, Z82170.2 and
            X82324.1.
            This sequence is a reference standard in the RefSeqGene project.
            On Dec 26, 2012 this sequence version replaced gi:194440735.
            
            Summary: This gene encodes a member of the POU-III class of neural
            transcription factors. This family member plays a role in inner ear
            development. The protein is thought to be involved in the mediation
            of epigenetic signals which induce striatal neuron-precursor
            differentiation. Mutations in this gene are associated with X
            chromosome-linked nonsyndromic mixed deafness. [provided by RefSeq,
            Dec 2012].
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1150              AK314967.1         1-1150
            1151-1415           Z82170.2           88174-88438
            1416-1507           X82324.1           1390-1481
FEATURES             Location/Qualifiers
     source          1..1507
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="X"
                     /map="Xq21.1"
     gene            1..1507
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /note="POU class 3 homeobox 4"
                     /db_xref="GeneID:5456"
                     /db_xref="HGNC:9217"
                     /db_xref="MIM:300039"
     exon            1..1507
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    14..16
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /note="upstream in-frame stop codon"
     STS             33..1271
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /db_xref="UniSTS:481354"
     variation       33
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374967521"
     STS             45..1280
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /db_xref="UniSTS:486237"
     CDS             65..1150
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /note="octamer-binding transcription factor 9;
                     brain-specific homeobox/POU domain protein 4"
                     /codon_start=1
                     /product="POU domain, class 3, transcription factor 4"
                     /protein_id="NP_000298.3"
                     /db_xref="GI:433288480"
                     /db_xref="CCDS:CCDS14450.1"
                     /db_xref="GeneID:5456"
                     /db_xref="HGNC:9217"
                     /db_xref="MIM:300039"
                     /translation="

MATAASNPYSILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDTSCHDL

"
     misc_feature    620..844
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /note="Found in Pit-Oct-Unc transcription factors; Region:
                     POU; smart00352"
                     /db_xref="CDD:197673"
     misc_feature    899..1072
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(899..913,917..919,968..970,986..988,1025..1027,
                     1031..1036,1043..1048,1052..1060,1064..1069)
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(905..907,914..916,1034..1036,1043..1048,1055..1057)
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     variation       148
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375349043"
     STS             152..1126
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /standard_name="Pou3f4"
                     /db_xref="UniSTS:144244"
     variation       154
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200127998"
     STS             186..833
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /standard_name="POU3F4"
                     /db_xref="UniSTS:498195"
     variation       203
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144417952"
     variation       226
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369124905"
     variation       232
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:372901057"
     variation       256
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376048374"
     variation       313
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370722742"
     variation       365
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375260287"
     variation       405
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111033343"
     variation       482
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:186010225"
     variation       496
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:148408866"
     variation       532
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377423111"
     variation       559
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:56143048"
     variation       563
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111033345"
     variation       570
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200696740"
     variation       649
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202020213"
     variation       668
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:104894920"
     variation       697
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368307448"
     variation       715
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:267606975"
     variation       772
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:111919890"
     variation       772
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:5921978"
     variation       773
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:5921979"
     variation       774..776
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:113043342"
     variation       862
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186990152"
     variation       874
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371128139"
     variation       884
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042659"
     variation       925
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374197546"
     variation       930
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191066633"
     variation       949
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:367805648"
     variation       959
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:267606974"
     variation       991..993
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace=""
                     /replace="ctc"
                     /db_xref="dbSNP:111033340"
     variation       999
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:387906502"
     variation       1014
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:104894921"
     variation       1028
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111033291"
     variation       1031
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:104894924"
     variation       1054
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:104894923"
     variation       1064
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:104894922"
     variation       1078
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140485350"
     variation       1096
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41312552"
     variation       1118
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:182912945"
     variation       1125
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144463918"
     variation       1172
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201213510"
     variation       1173
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375216358"
     STS             1265..1395
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /standard_name="RH79170"
                     /db_xref="UniSTS:34694"
     variation       1291
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368408951"
     variation       1410
                     /gene="POU3F4"
                     /gene_synonym="BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9;
                     OTF-9; OTF9"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147101869"
ORIGIN      

agatgtcaaaggctgaagctgctccctttgccacattataactagtaggggatcctcaccgaccatggccacagctgcctcgaatccctacagcattctcagttccacctccctagtccatgcggactctgcgggcatgcagcaggggagtcctttccgcaaccctcagaaacttctccaaagtgattacttgcagggagttcccagcaatgggcatcccctcgggcatcactgggtgaccagtctgagcgacgggggcccatggtcctccacactggccaccagccccctggaccagcaggacgtgaagcccgggcgcgaagacctgcaactgggtgcgatcatccatcaccgctcgccacacgtagcccaccactcaccgcacactaaccaccccaacgcctggggggccagcccggcaccgaacccgtctatcacgtcaagcggccaacccctcaacgtgtactcgcagcctggcttcaccgtgagcggcatgctggaacacgggggactcaccccacctccagctgccgcctctgcacagagcctgcacccggtgctccgagagcccccggatcacggcgaactgggctcgcaccattgccaggatcactccgacgaggagacgccaacctctgatgagttggaacagttcgccaaacaattcaaacaaagaagaatcaagttgggcttcacgcaggccgacgtggggttggcgctgggcacactgtatggtaacgtgttctcgcagaccaccatctgcaggttcgaggccttgcagctgagcttcaaaaatatgtgcaagctgaagcccctgctgaacaagtggctggaggaggcggattcgtccacagggagcccgaccagcattgacaagatcgctgcacagggccgcaagcgcaagaagcggacctccatcgaggtgagtgtcaagggcgtactggagacgcatttcctcaagtgtcccaagcctgccgcgcaggagatctcctcgctggcagacagcctccagttggagaaggaagtggtgcgtgtctggttctgtaatcgaagacaaaaagagaaaagaatgactccgccaggggatcagcagccgcatgaggtttattcgcacaccgtgaaaacagacacatcttgccatgatctctgactggaggaagcgaggaggcggccggccgcactgggagcagcgcggatttctctttctctctcactctcttcctttcattctagtattctttattatttttctctctctctcgttcgctcgctctctcgtactctctctcttttccctcctttcctttttctttcctttcccctttttctttcccttctttttccctttcctttcctttcattttctttcctttccccttcccttcccttcccttccatctcttcctttcctttcctttcttttcttttgctttcctttcctttttttcccttttctttccttttcataagaggttctaacttctgttgacaaaggaaacacatactc

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:5456 -> Molecular function: GO:0003680 [AT DNA binding] evidence: IEA
            GeneID:5456 -> Molecular function: GO:0003690 [double-stranded DNA binding] evidence: IEA
            GeneID:5456 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:5456 -> Biological process: GO:0006366 [transcription from RNA polymerase II promoter] evidence: IEA
            GeneID:5456 -> Biological process: GO:0007605 [sensory perception of sound] evidence: IEA
            GeneID:5456 -> Biological process: GO:0021879 [forebrain neuron differentiation] evidence: IEA
            GeneID:5456 -> Biological process: GO:0090103 [cochlea morphogenesis] evidence: ISS
            GeneID:5456 -> Biological process: GO:2001054 [negative regulation of mesenchymal cell apoptotic process] evidence: ISS
            GeneID:5456 -> Cellular component: GO:0005634 [nucleus] evidence: IEA