Home |
Help |
Advanced search
2025-05-09 18:30:42, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_014046 1536 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens mitochondrial ribosomal protein S18B (MRPS18B), mRNA.
ACCESSION NM_014046
VERSION NM_014046.3 GI:186928836
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1536)
AUTHORS Hendrickson,S.L., Lautenberger,J.A., Chinn,L.W., Malasky,M.,
Sezgin,E., Kingsley,L.A., Goedert,J.J., Kirk,G.D., Gomperts,E.D.,
Buchbinder,S.P., Troyer,J.L. and O'Brien,S.J.
TITLE Genetic variants in nuclear-encoded mitochondrial genes influence
AIDS progression
JOURNAL PLoS ONE 5 (9), E12862 (2010)
PUBMED 20877624
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
Publication Status: Online-Only
REFERENCE 2 (bases 1 to 1536)
AUTHORS Barcellos,L.F., May,S.L., Ramsay,P.P., Quach,H.L., Lane,J.A.,
Nititham,J., Noble,J.A., Taylor,K.E., Quach,D.L., Chung,S.A.,
Kelly,J.A., Moser,K.L., Behrens,T.W., Seldin,M.F., Thomson,G.,
Harley,J.B., Gaffney,P.M. and Criswell,L.A.
TITLE High-density SNP screening of the major histocompatibility complex
in systemic lupus erythematosus demonstrates strong evidence for
independent susceptibility regions
JOURNAL PLoS Genet. 5 (10), E1000696 (2009)
PUBMED 19851445
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 3 (bases 1 to 1536)
AUTHORS Kashuba,E., Yurchenko,M., Yenamandra,S.P., Snopok,B.,
Isaguliants,M., Szekely,L. and Klein,G.
TITLE EBV-encoded EBNA-6 binds and targets MRS18-2 to the nucleus,
resulting in the disruption of pRb-E2F1 complexes
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 105 (14), 5489-5494 (2008)
PUBMED 18391203
REMARK GeneRIF: EBNA-6 {ebna-3c} binds to MRPS18-2 , and targets it to the
nucleus; binding targets the small pocket of pRb, which is a site
of interaction with E2F1. The MRPS18-2 competes with the binding of
E2F1 to pRb, thereby raising the level of free E2F1
REFERENCE 4 (bases 1 to 1536)
AUTHORS Shiina,T., Ota,M., Shimizu,S., Katsuyama,Y., Hashimoto,N.,
Takasu,M., Anzai,T., Kulski,J.K., Kikkawa,E., Naruse,T., Kimura,N.,
Yanagiya,K., Watanabe,A., Hosomichi,K., Kohara,S., Iwamoto,C.,
Umehara,Y., Meyer,A., Wanner,V., Sano,K., Macquin,C., Ikeo,K.,
Tokunaga,K., Gojobori,T., Inoko,H. and Bahram,S.
TITLE Rapid evolution of major histocompatibility complex class I genes
in primates generates new disease alleles in humans via hitchhiking
diversity
JOURNAL Genetics 173 (3), 1555-1570 (2006)
PUBMED 16702430
REFERENCE 5 (bases 1 to 1536)
AUTHORS Zhang,Z. and Gerstein,M.
TITLE Identification and characterization of over 100 mitochondrial
ribosomal protein pseudogenes in the human genome
JOURNAL Genomics 81 (5), 468-480 (2003)
PUBMED 12706105
REFERENCE 6 (bases 1 to 1536)
AUTHORS Suzuki,T., Terasaki,M., Takemoto-Hori,C., Hanada,T., Ueda,T.,
Wada,A. and Watanabe,K.
TITLE Proteomic analysis of the mammalian mitochondrial ribosome.
Identification of protein components in the 28 S small subunit
JOURNAL J. Biol. Chem. 276 (35), 33181-33195 (2001)
PUBMED 11402041
REFERENCE 7 (bases 1 to 1536)
AUTHORS Cavdar Koc,E., Burkhart,W., Blackburn,K., Moseley,A. and
Spremulli,L.L.
TITLE The small subunit of the mammalian mitochondrial ribosome.
Identification of the full complement of ribosomal proteins present
JOURNAL J. Biol. Chem. 276 (22), 19363-19374 (2001)
PUBMED 11279123
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BP369345.1, BG773408.1,
AF100761.1 and BE220785.1.
On Apr 29, 2008 this sequence version replaced gi:16554601.
Summary: Mammalian mitochondrial ribosomal proteins are encoded by
nuclear genes and help in protein synthesis within the
mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a
small 28S subunit and a large 39S subunit. They have an estimated
75% protein to rRNA composition compared to prokaryotic ribosomes,
where this ratio is reversed. Another difference between mammalian
mitoribosomes and prokaryotic ribosomes is that the latter contain
a 5S rRNA. Among different species, the proteins comprising the
mitoribosome differ greatly in sequence, and sometimes in
biochemical properties, which prevents easy recognition by sequence
homology. This gene encodes a 28S subunit protein that belongs to
the ribosomal protein S18P family. The encoded protein is one of
three that has significant sequence similarity to bacterial S18
proteins. The primary sequences of the three human mitochondrial
S18 proteins are no more closely related to each other than they
are to the prokaryotic S18 proteins. Pseudogenes corresponding to
this gene are found on chromosomes 1q and 2q. [provided by RefSeq,
Jul 2008].
##Evidence-Data-START##
Transcript exon combination :: AF151017.1, AF100761.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
gene product(s) localized to mito. :: reported by MitoCarta
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-103 BP369345.1 1-103
104-151 BG773408.1 95-142
152-1527 AF100761.1 7-1382
1528-1536 BE220785.1 1-9 c
FEATURES Location/Qualifiers
source 1..1536
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="6"
/map="6p21.3"
gene 1..1536
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/note="mitochondrial ribosomal protein S18B"
/db_xref="GeneID:28973"
/db_xref="HGNC:14516"
/db_xref="HPRD:14781"
/db_xref="MIM:611982"
exon 1..235
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/inference="alignment:Splign:1.39.8"
variation 57
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:142627502"
variation 110
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:146036133"
variation 118
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:377027469"
variation 124
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:369817736"
variation 137
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:17189183"
variation 142
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:199867691"
variation 147
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:200725313"
CDS 158..934
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/note="mitochondrial ribosomal protein S18-2; S18mt-b;
mrps18-b; MRP-S18-b; 28S ribosomal protein S18-2,
mitochondrial"
/codon_start=1
/product="28S ribosomal protein S18b, mitochondrial"
/protein_id="NP_054765.1"
/db_xref="GI:7662645"
/db_xref="CCDS:CCDS4682.1"
/db_xref="GeneID:28973"
/db_xref="HGNC:14516"
/db_xref="HPRD:14781"
/db_xref="MIM:611982"
/translation="
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL
"
misc_feature 482..646
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/note="Ribosomal protein S18; Region: Ribosomal_S18;
pfam01084"
/db_xref="CDD:201589"
variation 161
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:137926274"
variation 162
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:375661910"
variation 183
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="t"
/db_xref="dbSNP:368332564"
variation 191
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:372011234"
variation 197
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:140942217"
variation 198
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="g"
/db_xref="dbSNP:144600886"
variation 205
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="c"
/db_xref="dbSNP:138552206"
variation 206
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:11555739"
variation 209
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:116707717"
exon 236..344
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/inference="alignment:Splign:1.39.8"
variation 292
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:35115248"
variation 293
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:373782294"
variation 297
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:150787623"
variation 320
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:149504170"
exon 345..442
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/inference="alignment:Splign:1.39.8"
variation 361
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:147201268"
variation 369
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:140805833"
variation 373
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:188820794"
variation 374
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:144768627"
variation 389
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:147483597"
variation 423
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:113079348"
variation 429
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:148496697"
exon 443..511
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/inference="alignment:Splign:1.39.8"
variation 444
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:199725053"
variation 445
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="t"
/db_xref="dbSNP:115237884"
variation 505
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:367682122"
exon 512..578
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/inference="alignment:Splign:1.39.8"
variation 515
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:116524936"
variation 532
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:200282715"
variation 542
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:371898376"
variation 549
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:55637991"
variation 561
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="t"
/db_xref="dbSNP:114474320"
variation 564
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:200954069"
exon 579..638
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/inference="alignment:Splign:1.39.8"
variation 602
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:151108350"
variation 603
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:141114241"
exon 639..1534
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/inference="alignment:Splign:1.39.8"
variation 696
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:146860483"
variation 728
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="g"
/db_xref="dbSNP:372687363"
variation 743
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:17849985"
variation 783
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:140902930"
variation 784
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:145393589"
variation 801
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:144633864"
variation 806
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:376095160"
variation 838
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:201762194"
variation 844
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="g"
/db_xref="dbSNP:148815125"
variation 845
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="g"
/db_xref="dbSNP:34315095"
variation 870
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:372681182"
variation 882
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:116693618"
variation 888
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:148828689"
variation 966
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="g"
/db_xref="dbSNP:377043280"
variation 1017
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="c"
/db_xref="dbSNP:142489658"
variation 1028
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="t"
/db_xref="dbSNP:183236532"
variation 1090
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="g"
/replace="t"
/db_xref="dbSNP:187747154"
variation 1129
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:201971528"
variation 1151
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="c"
/db_xref="dbSNP:192259088"
variation 1167
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:371876825"
variation 1225
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="g"
/db_xref="dbSNP:374097554"
variation 1233..1234
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace=""
/replace="a"
/db_xref="dbSNP:35997671"
variation 1245..1248
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace=""
/replace="aaaa"
/db_xref="dbSNP:368057496"
variation 1247..1248
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace=""
/replace="aa"
/db_xref="dbSNP:71767101"
variation 1249..1250
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace=""
/replace="a"
/db_xref="dbSNP:71552012"
variation 1289
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:146455019"
variation 1342
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:75407659"
STS 1347..1476
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/standard_name="RH102456"
/db_xref="UniSTS:96790"
variation 1351
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="c"
/replace="t"
/db_xref="dbSNP:372073637"
variation 1398
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:376685424"
variation 1427
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:369731283"
variation 1462
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:111850078"
variation 1487
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="g"
/db_xref="dbSNP:112418429"
polyA_signal 1506..1511
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
polyA_site 1526
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
polyA_site 1527
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
variation 1529
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
/replace="a"
/replace="t"
/db_xref="dbSNP:111609724"
polyA_site 1532
/gene="MRPS18B"
/gene_synonym="C6orf14; HSPC183; HumanS18a; MRP-S18-2;
MRPS18-2; PTD017; S18amt"
ORIGIN
agcttctcccccatgccttccctttcacgcttccgtcctgacgcaaacgtggggccgccttccgcactgcgggcttgtccttggccctgccctactcagtttcctgaagcatgcgcagttgcctttccgtcaattcctgtcctgggcgtacgtcaagatggcggcgtctgtattaaacaccgtgctgaggcggcttcctatgctatctctcttccgaggttctcacagagttcaggttcccctccagactctttgcaccaaagctccctctgaggaagattctttgtcctcagttcccatttctccttataaggatgagccctggaaatatctggaatcagaagaataccaggagcgatatggttctcgccccgtctgggctgactaccgccgcaaccacaagggtggtgtacccccacagcggactcggaagacatgtattcgtcggaataaagttgttgggaatccctgccccatctgtcgagatcacaagttgcatgttgactttaggaacgtgaagctcttggagcaatttgtctgcgcccacacgggtatcatcttctatgctccatacacaggagtctgtgtgaagcagcacaagcggttgacccaggccatccagaaagccagggatcatggtctcctcatttaccacatcccccaggttgaaccacgggaccttgacttcagtacctctcatggggctgtgagtgctactccgccagcccccaccctggtctcaggtgacccctggtacccatggtacaactggaaacagccaccggagagagaactgtctcgccttcgccggctttaccagggtcatctccaagaagagagtggccccccacctgagtcaatgcccaagatgccccctagaacaccagcggaagcctcctccactgggcagacaggccctcagagtgctctgtaggagctgtagactgggaagagaggccaggcgtggtggctcactcctgtaatcccagcactttgggaagccaaggtgggctgatcacttgatcccaggagtttgagaccagcctgggcaccatggtgaaacctcgtctttaccaaaaaatacaaaaattagctgggtgtggtggtgcacacctgtagtctcaactattggggaggctaaggtaggatcacttgatcccaggaggcggaggttgcagtgagttgcagtcacacccctgcactccagcctgggtgacagctagaccctgtctcaaaaaaaaaaaaaaagactgggaagagagctagagggactaggagataatgtgtatgtaggtttatgtgatgggatatcaccctgaagagttgtgtcttttgtggccagtgacaaatccaggaaatgaatgttgctgatagggataaatcttgaggctgagggcgggtggtacagatgtgtatgggaaaccccaacccctatatattgtaaatagatgggctgggctaaacattgttgccgtttcatacttctaccaactcagcttttacacaataaagctctactgtctctggtttgcttaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:28973 -> Molecular function: GO:0003735 [structural constituent of ribosome] evidence: NAS
GeneID:28973 -> Biological process: GO:0006412 [translation] evidence: NAS
GeneID:28973 -> Cellular component: GO:0005763 [mitochondrial small ribosomal subunit] evidence: NAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.