GGRNA Home | Help | Advanced search

2025-05-09 18:34:05, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_002623               1383 bp    mRNA    linear   PRI 16-JUN-2013
DEFINITION  Homo sapiens prefoldin subunit 4 (PFDN4), mRNA.
ACCESSION   NM_002623
VERSION     NM_002623.3  GI:54792079
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1383)
  AUTHORS   Hirota,T., Takahashi,A., Kubo,M., Tsunoda,T., Tomita,K.,
            Sakashita,M., Yamada,T., Fujieda,S., Tanaka,S., Doi,S.,
            Miyatake,A., Enomoto,T., Nishiyama,C., Nakano,N., Maeda,K.,
            Okumura,K., Ogawa,H., Ikeda,S., Noguchi,E., Sakamoto,T., Hizawa,N.,
            Ebe,K., Saeki,H., Sasaki,T., Ebihara,T., Amagai,M., Takeuchi,S.,
            Furue,M., Nakamura,Y. and Tamari,M.
  TITLE     Genome-wide association study identifies eight new susceptibility
            loci for atopic dermatitis in the Japanese population
  JOURNAL   Nat. Genet. 44 (11), 1222-1226 (2012)
   PUBMED   23042114
REFERENCE   2  (bases 1 to 1383)
  AUTHORS   Comuzzie,A.G., Cole,S.A., Laston,S.L., Voruganti,V.S., Haack,K.,
            Gibbs,R.A. and Butte,N.F.
  TITLE     Novel genetic loci identified for the pathophysiology of childhood
            obesity in the Hispanic population
  JOURNAL   PLoS ONE 7 (12), E51954 (2012)
   PUBMED   23251661
REFERENCE   3  (bases 1 to 1383)
  AUTHORS   Miyoshi,N., Ishii,H., Mimori,K., Nishida,N., Tokuoka,M., Akita,H.,
            Sekimoto,M., Doki,Y. and Mori,M.
  TITLE     Abnormal expression of PFDN4 in colorectal cancer: a novel marker
            for prognosis
  JOURNAL   Ann. Surg. Oncol. 17 (11), 3030-3036 (2010)
   PUBMED   20552408
  REMARK    GeneRIF: PFDN4 inhibition resulted in an increase in cell growth
            and invasiveness in colorectal cancer cell lines.
REFERENCE   4  (bases 1 to 1383)
  AUTHORS   Djouder,N., Metzler,S.C., Schmidt,A., Wirbelauer,C., Gstaiger,M.,
            Aebersold,R., Hess,D. and Krek,W.
  TITLE     S6K1-mediated disassembly of mitochondrial URI/PP1gamma complexes
            activates a negative feedback program that counters S6K1 survival
            signaling
  JOURNAL   Mol. Cell 28 (1), 28-40 (2007)
   PUBMED   17936702
REFERENCE   5  (bases 1 to 1383)
  AUTHORS   Simons,C.T., Staes,A., Rommelaere,H., Ampe,C., Lewis,S.A. and
            Cowan,N.J.
  TITLE     Selective contribution of eukaryotic prefoldin subunits to actin
            and tubulin binding
  JOURNAL   J. Biol. Chem. 279 (6), 4196-4203 (2004)
   PUBMED   14634002
REFERENCE   6  (bases 1 to 1383)
  AUTHORS   Deloukas,P., Matthews,L.H., Ashurst,J., Burton,J., Gilbert,J.G.,
            Jones,M., Stavrides,G., Almeida,J.P., Babbage,A.K., Bagguley,C.L.,
            Bailey,J., Barlow,K.F., Bates,K.N., Beard,L.M., Beare,D.M.,
            Beasley,O.P., Bird,C.P., Blakey,S.E., Bridgeman,A.M., Brown,A.J.,
            Buck,D., Burrill,W., Butler,A.P., Carder,C., Carter,N.P.,
            Chapman,J.C., Clamp,M., Clark,G., Clark,L.N., Clark,S.Y.,
            Clee,C.M., Clegg,S., Cobley,V.E., Collier,R.E., Connor,R.,
            Corby,N.R., Coulson,A., Coville,G.J., Deadman,R., Dhami,P.,
            Dunn,M., Ellington,A.G., Frankland,J.A., Fraser,A., French,L.,
            Garner,P., Grafham,D.V., Griffiths,C., Griffiths,M.N., Gwilliam,R.,
            Hall,R.E., Hammond,S., Harley,J.L., Heath,P.D., Ho,S., Holden,J.L.,
            Howden,P.J., Huckle,E., Hunt,A.R., Hunt,S.E., Jekosch,K.,
            Johnson,C.M., Johnson,D., Kay,M.P., Kimberley,A.M., King,A.,
            Knights,A., Laird,G.K., Lawlor,S., Lehvaslaiho,M.H., Leversha,M.,
            Lloyd,C., Lloyd,D.M., Lovell,J.D., Marsh,V.L., Martin,S.L.,
            McConnachie,L.J., McLay,K., McMurray,A.A., Milne,S., Mistry,D.,
            Moore,M.J., Mullikin,J.C., Nickerson,T., Oliver,K., Parker,A.,
            Patel,R., Pearce,T.A., Peck,A.I., Phillimore,B.J.,
            Prathalingam,S.R., Plumb,R.W., Ramsay,H., Rice,C.M., Ross,M.T.,
            Scott,C.E., Sehra,H.K., Shownkeen,R., Sims,S., Skuce,C.D.,
            Smith,M.L., Soderlund,C., Steward,C.A., Sulston,J.E., Swann,M.,
            Sycamore,N., Taylor,R., Tee,L., Thomas,D.W., Thorpe,A., Tracey,A.,
            Tromans,A.C., Vaudin,M., Wall,M., Wallis,J.M., Whitehead,S.L.,
            Whittaker,P., Willey,D.L., Williams,L., Williams,S.A., Wilming,L.,
            Wray,P.W., Hubbard,T., Durbin,R.M., Bentley,D.R., Beck,S. and
            Rogers,J.
  TITLE     The DNA sequence and comparative analysis of human chromosome 20
  JOURNAL   Nature 414 (6866), 865-871 (2001)
   PUBMED   11780052
REFERENCE   7  (bases 1 to 1383)
  AUTHORS   Cowan,N.J. and Lewis,S.A.
  TITLE     A chaperone with a hydrophilic surface
  JOURNAL   Nat. Struct. Biol. 6 (11), 990-991 (1999)
   PUBMED   10542082
REFERENCE   8  (bases 1 to 1383)
  AUTHORS   Hansen,W.J., Cowan,N.J. and Welch,W.J.
  TITLE     Prefoldin-nascent chain complexes in the folding of cytoskeletal
            proteins
  JOURNAL   J. Cell Biol. 145 (2), 265-277 (1999)
   PUBMED   10209023
REFERENCE   9  (bases 1 to 1383)
  AUTHORS   Vainberg,I.E., Lewis,S.A., Rommelaere,H., Ampe,C.,
            Vandekerckhove,J., Klein,H.L. and Cowan,N.J.
  TITLE     Prefoldin, a chaperone that delivers unfolded proteins to cytosolic
            chaperonin
  JOURNAL   Cell 93 (5), 863-873 (1998)
   PUBMED   9630229
REFERENCE   10 (bases 1 to 1383)
  AUTHORS   Iijima,M., Kano,Y., Nohno,T. and Namba,M.
  TITLE     Cloning of cDNA with possible transcription factor activity at the
            G1-S phase transition in human fibroblast cell lines
  JOURNAL   Acta Med. Okayama 50 (2), 73-77 (1996)
   PUBMED   8744932
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CN482830.1, BC010953.1,
            U41816.1 and AL133335.29.
            On Oct 28, 2004 this sequence version replaced gi:12408676.
            
            Summary: This gene encodes a member of the prefoldin beta subunit
            family. The encoded protein is one of six subunits of prefoldin, a
            molecular chaperone complex that binds and stabilizes newly
            synthesized polypeptides, thereby allowing them to fold correctly.
            The complex, consisting of two alpha and four beta subunits, forms
            a double beta barrel assembly with six protruding coiled-coils.
            [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U41816.1, BM806238.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-124               CN482830.1         1-124
            125-590             BC010953.1         5-470
            591-605             U41816.1           452-466
            606-1329            AL133335.29        41883-42606
            1330-1383           U41816.1           1188-1241
FEATURES             Location/Qualifiers
     source          1..1383
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="20"
                     /map="20q13.2"
     gene            1..1383
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /note="prefoldin subunit 4"
                     /db_xref="GeneID:5203"
                     /db_xref="HGNC:8868"
                     /db_xref="HPRD:05358"
                     /db_xref="MIM:604898"
     exon            1..162
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    124..126
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /note="upstream in-frame stop codon"
     CDS             139..543
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /note="prefoldin 4; protein C-1"
                     /codon_start=1
                     /product="prefoldin subunit 4"
                     /protein_id="NP_002614.2"
                     /db_xref="GI:12408677"
                     /db_xref="CCDS:CCDS13445.1"
                     /db_xref="GeneID:5203"
                     /db_xref="HGNC:8868"
                     /db_xref="HPRD:05358"
                     /db_xref="MIM:604898"
                     /translation="
MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES
"
     misc_feature    196..516
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /note="Prefoldin subunit; Region: Prefoldin_2; pfam01920"
                     /db_xref="CDD:202045"
     misc_feature    511..513
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q9NQP4.1); phosphorylation site"
     exon            163..270
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /inference="alignment:Splign:1.39.8"
     variation       190
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:6127140"
     STS             207..389
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /standard_name="RH47160"
                     /db_xref="UniSTS:789"
     STS             207..333
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /standard_name="RH47163"
                     /db_xref="UniSTS:788"
     STS             220..377
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /standard_name="SHGC-2608"
                     /db_xref="UniSTS:34776"
     exon            271..411
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /inference="alignment:Splign:1.39.8"
     variation       279
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:376961672"
     variation       319
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148299643"
     variation       327
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369214934"
     variation       387
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76841395"
     exon            412..1346
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /inference="alignment:Splign:1.39.8"
     variation       435
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145690568"
     variation       436
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368220174"
     variation       467
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199901569"
     variation       539
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115409787"
     polyA_signal    573..578
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
     polyA_site      596
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
     variation       726
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143697055"
     polyA_signal    785..790
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
     polyA_site      810
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
     variation       878..880
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /replace=""
                     /replace="tgt"
                     /db_xref="dbSNP:150624897"
     variation       928
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6023044"
     variation       1167
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377687060"
     variation       1210
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371165467"
     polyA_signal    1324..1329
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
     variation       1331
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:180795020"
     polyA_site      1346
                     /gene="PFDN4"
                     /gene_synonym="C1; PFD4"
ORIGIN      
aaagtccaagaggacggaatgtggagacagtgttgtatttttgcggggagttctaggccgaccgggagcgagagaacgctcgggggcgaagcgcgccattgcggccctccccgccgcctgcggtagtccagtcccaagatggcggccaccatgaagaaggcggctgcagaagatgtcaatgttactttcgaagatcaacaaaagataaacaaatttgcacggaatacaagtagaatcacagagctgaaggaagaaatagaagtaaaaaagaaacaactccaaaacctagaagatgcttgtgatgacatcatgcttgcagatgatgattgcttaatgataccttatcaaattggtgatgtcttcattagccattctcaagaagaaacgcaagaaatgttagaagaagcaaagaaaaatttgcaagaagaaattgacgccttagaatccagagtggaatcaattcagcgagtgttagcagatttgaaagttcagttgtatgcaaaattcgggagcaacataaaccttgaagctgatgaaagttaaacattttataatactttttttatttgtttaataaacttgaatattgtttaaaatgataattttccttcttcaaatgacatggaaagcaaaactttcttttttaaaaattttcatttatttaatggaaacttgcccattttcacatgtctgcttatttattttatatttttaaaagaagacagtattcacctatgtattttgcataacgattatatcaagtctaggggcttcatgtcatgttattaaaatcagttaagcaatcttttatgtttctatattatttagaatatttgttgttgcaattttcacataagaaaatttaacagttgtgtcatgttgtttctgtctgattttaattgctgtctaatgacggggaaagcacgatgaaaagatgtacaatcctgcatccttgcttatttcacaactaaagctttgtcatagacttcaaaatatatatgtatatattttatttaaatatatgttacatattatatttaaacatacatatttaacattttttacatatctatcaatatcagagatttgggtaaaagaatgggtaatgtttaaacatgtggaggcatgtggagctttatacaaacagggcagaaccacagaagaacgttttagaaaccaagagatgtgcagaaagaaatgtttagtgttttttcgttttaaattttagattttattttagtgctttgtaattaattggggtttatattgataaagatgtggaagttaaacagctatgtatgtaaaagtaaggcttatttcttaaataaaggatgcatttcttcccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:5203 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:5203 -> Molecular function: GO:0051082 [unfolded protein binding] evidence: IEA
            GeneID:5203 -> Molecular function: GO:0051087 [chaperone binding] evidence: TAS
            GeneID:5203 -> Biological process: GO:0006457 [protein folding] evidence: TAS
            GeneID:5203 -> Biological process: GO:0044267 [cellular protein metabolic process] evidence: TAS
            GeneID:5203 -> Biological process: GO:0051084 ['de novo' posttranslational protein folding] evidence: TAS
            GeneID:5203 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
            GeneID:5203 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
            GeneID:5203 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA
            GeneID:5203 -> Cellular component: GO:0005829 [cytosol] evidence: NAS
            GeneID:5203 -> Cellular component: GO:0016272 [prefoldin complex] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.