Home |
Help |
Advanced search
2025-05-09 19:01:06, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001164803 2071 bp mRNA linear PRI 31-MAY-2013
DEFINITION Homo sapiens RNA binding motif protein, X-linked (RBMX), transcript
variant 2, mRNA.
ACCESSION NM_001164803
VERSION NM_001164803.1 GI:258645149
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2071)
AUTHORS Matsunaga,S., Takata,H., Morimoto,A., Hayashihara,K., Higashi,T.,
Akatsuchi,K., Mizusawa,E., Yamakawa,M., Ashida,M., Matsunaga,T.M.,
Azuma,T., Uchiyama,S. and Fukui,K.
TITLE RBMX: a regulator for maintenance and centromeric protection of
sister chromatid cohesion
JOURNAL Cell Rep 1 (4), 299-308 (2012)
PUBMED 22832223
REMARK GeneRIF: RBMX is a cohesion regulator that maintains the proper
cohesion of sister chromatids.
REFERENCE 2 (bases 1 to 2071)
AUTHORS Adamson,B., Smogorzewska,A., Sigoillot,F.D., King,R.W. and
Elledge,S.J.
TITLE A genome-wide homologous recombination screen identifies the
RNA-binding protein RBMX as a component of the DNA-damage response
JOURNAL Nat. Cell Biol. 14 (3), 318-328 (2012)
PUBMED 22344029
REMARK GeneRIF: Data show that RBMX accumulated at DNA lesions through
multiple domains in a poly(ADP-ribose) polymerase 1-dependent
manner and promoted HR by facilitating proper BRCA2 expression.
Publication Status: Online-Only
REFERENCE 3 (bases 1 to 2071)
AUTHORS Shin,K.H., Kim,R.H., Yu,B., Kang,M.K., Elashoff,D., Christensen,R.,
Pucar,A. and Park,N.H.
TITLE Expression and mutation analysis of heterogeneous nuclear
ribonucleoprotein G in human oral cancer
JOURNAL Oral Oncol. 47 (11), 1011-1016 (2011)
PUBMED 21840245
REMARK GeneRIF: studied the genetic and expression states of hnRNP G in
normal, premalignant and malignant human oral tissues to further
understand the relationship between the hnRNP G alterations and the
development of human oral cancer
REFERENCE 4 (bases 1 to 2071)
AUTHORS Heinrich,B., Zhang,Z., Raitskin,O., Hiller,M., Benderska,N.,
Hartmann,A.M., Bracco,L., Elliott,D., Ben-Ari,S., Soreq,H.,
Sperling,J., Sperling,R. and Stamm,S.
TITLE Heterogeneous nuclear ribonucleoprotein G regulates splice site
selection by binding to CC(A/C)-rich regions in pre-mRNA
JOURNAL J. Biol. Chem. 284 (21), 14303-14315 (2009)
PUBMED 19282290
REFERENCE 5 (bases 1 to 2071)
AUTHORS Shin,K.H., Kim,R.H., Kim,R.H., Kang,M.K. and Park,N.H.
TITLE hnRNP G elicits tumor-suppressive activity in part by upregulating
the expression of Txnip
JOURNAL Biochem. Biophys. Res. Commun. 372 (4), 880-885 (2008)
PUBMED 18541147
REMARK GeneRIF: These studies indicate that hnRNP G promotes the
expression of Txnip and mediates its tumor-suppressive effect.
REFERENCE 6 (bases 1 to 2071)
AUTHORS Mazeyrat,S., Saut,N., Mattei,M.G. and Mitchell,M.J.
TITLE RBMY evolved on the Y chromosome from a ubiquitously transcribed
X-Y identical gene
JOURNAL Nat. Genet. 22 (3), 224-226 (1999)
PUBMED 10391207
REFERENCE 7 (bases 1 to 2071)
AUTHORS Delbridge,M.L., Lingenfelter,P.A., Disteche,C.M. and Graves,J.A.
TITLE The candidate spermatogenesis gene RBMY has a homologue on the
human X chromosome
JOURNAL Nat. Genet. 22 (3), 223-224 (1999)
PUBMED 10391206
REFERENCE 8 (bases 1 to 2071)
AUTHORS Venables,J.P., Vernet,C., Chew,S.L., Elliott,D.J., Cowmeadow,R.B.,
Wu,J., Cooke,H.J., Artzt,K. and Eperon,I.C.
TITLE T-STAR/ETOILE: a novel relative of SAM68 that interacts with an
RNA-binding protein implicated in spermatogenesis
JOURNAL Hum. Mol. Genet. 8 (6), 959-969 (1999)
PUBMED 10332027
REFERENCE 9 (bases 1 to 2071)
AUTHORS Soulard,M., Della Valle,V., Siomi,M.C., Pinol-Roma,S., Codogno,P.,
Bauvy,C., Bellini,M., Lacroix,J.C., Monod,G., Dreyfuss,G. et al.
TITLE hnRNP G: sequence and characterization of a glycosylated
RNA-binding protein
JOURNAL Nucleic Acids Res. 21 (18), 4210-4217 (1993)
PUBMED 7692398
REFERENCE 10 (bases 1 to 2071)
AUTHORS Le Coniat,M., Soulard,M., Della Valle,V., Larsen,C.J. and Berger,R.
TITLE Localization of the human gene encoding heterogeneous nuclear RNA
ribonucleoprotein G (hnRNP-G) to chromosome 6p12
JOURNAL Hum. Genet. 88 (5), 593-595 (1992)
PUBMED 1551662
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BM147410.1, DC337568.1,
AK304868.1 and BX647131.1.
This sequence is a reference standard in the RefSeqGene project.
Summary: This gene belongs to the RBMY gene family which includes
candidate Y chromosome spermatogenesis genes. This gene, an active
X chromosome homolog of the Y chromosome RBMY gene, is widely
expressed whereas the RBMY gene evolved a male-specific function in
spermatogenesis. Pseudogenes of this gene, found on chromosomes 1,
4, 9, 11, and 6, were likely derived by retrotransposition from the
original gene. Alternatively spliced transcript variants encoding
different isoforms have been identified. A snoRNA gene (SNORD61) is
found in one of its introns. [provided by RefSeq, Sep 2009].
Transcript Variant: This variant (2) lacks several alternate exon
and contains a different 3' end, compared to variant 1. The
resulting protein (isoform 2) is shorter and has a distinct
C-terminus when it is compared to variant 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AK304868.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025088 [ECO:0000348]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-209 BM147410.1 1-209
210-319 DC337568.1 155-264
320-828 AK304868.1 265-773
829-2071 BX647131.1 3662-4904
FEATURES Location/Qualifiers
source 1..2071
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="X"
/map="Xq26.3"
gene 1..2071
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/note="RNA binding motif protein, X-linked"
/db_xref="GeneID:27316"
/db_xref="HGNC:9910"
/db_xref="MIM:300199"
exon 1..184
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/inference="alignment:Splign:1.39.8"
misc_feature 163..165
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/note="upstream in-frame stop codon"
exon 185..319
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/inference="alignment:Splign:1.39.8"
variation 210
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="a"
/replace="c"
/db_xref="dbSNP:2011584"
CDS 211..801
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/note="isoform 2 is encoded by transcript variant 2; RNA
binding motif protein, X chromosome; heterogeneous nuclear
ribonucleoprotein G; hnRNP G; glycoprotein p43;
RNA-binding motif protein, X chromosome"
/codon_start=1
/product="RNA-binding motif protein, X chromosome isoform
2"
/protein_id="NP_001158275.1"
/db_xref="GI:258645150"
/db_xref="CCDS:CCDS55510.1"
/db_xref="GeneID:27316"
/db_xref="HGNC:9910"
/db_xref="MIM:300199"
/translation="
MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKLLYHVEEIVMEVHLEGNRCPLVEMFICPQEMMGILLKTAIQAEITQVLVILEIMHHHHEIILTVIMVIPVHVMTIHQEDIAIEMDMVVIVTIQIIQVEVPTEIHMRVMVGDFAHYGRGVLIDSQ
"
misc_feature <211..>435
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/note="RNA-binding proteins (RRM domain) [General function
prediction only]; Region: COG0724"
/db_xref="CDD:31068"
misc_feature 235..432
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/note="RRM (RNA recognition motif), also known as RBD (RNA
binding domain) or RNP (ribonucleoprotein domain), is a
highly abundant domain in eukaryotes found in proteins
involved in post-transcriptional gene expression processes
including mRNA and rRNA...; Region: RRM; cd00590"
/db_xref="CDD:100104"
misc_feature order(241..243,361..363,367..369)
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/note="RNA/DNA binding site [nucleotide binding]; other
site"
/db_xref="CDD:100104"
exon 320..426
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/inference="alignment:Splign:1.39.8"
exon 427..541
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/inference="alignment:Splign:1.39.8"
variation 509
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="c"
/replace="t"
/db_xref="dbSNP:1056264"
exon 542..667
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/inference="alignment:Splign:1.39.8"
variation 637
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="c"
/replace="t"
/db_xref="dbSNP:11556431"
exon 668..750
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/inference="alignment:Splign:1.39.8"
variation 693
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="c"
/replace="t"
/db_xref="dbSNP:374604645"
exon 751..828
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/inference="alignment:Splign:1.39.8"
exon 829..2052
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/inference="alignment:Splign:1.39.8"
variation 991
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="c"
/replace="g"
/db_xref="dbSNP:3209406"
variation 1201
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="c"
/replace="g"
/db_xref="dbSNP:3209407"
variation 1207
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="a"
/replace="g"
/db_xref="dbSNP:3209408"
variation 1241
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="g"
/replace="t"
/db_xref="dbSNP:3209409"
variation 1319
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="a"
/replace="g"
/db_xref="dbSNP:3209410"
variation 1656
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="g"
/replace="t"
/db_xref="dbSNP:3209412"
variation 1659
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="a"
/replace="g"
/db_xref="dbSNP:1053044"
variation 1681
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="c"
/replace="g"
/db_xref="dbSNP:1053053"
variation 1686
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="c"
/replace="t"
/db_xref="dbSNP:1053065"
variation 1690
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="c"
/replace="t"
/db_xref="dbSNP:1053069"
variation 1694
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="c"
/replace="t"
/db_xref="dbSNP:1053075"
variation 1700
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1053083"
variation 1716
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="a"
/replace="c"
/db_xref="dbSNP:1063808"
variation 1734
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="c"
/replace="t"
/db_xref="dbSNP:1053103"
variation 1743
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="a"
/replace="g"
/db_xref="dbSNP:1053111"
variation 1749
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="c"
/replace="t"
/db_xref="dbSNP:1053114"
variation 1763
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="a"
/replace="g"
/db_xref="dbSNP:1053121"
variation 1777
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="c"
/replace="t"
/db_xref="dbSNP:1053122"
variation 1801
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="a"
/replace="t"
/db_xref="dbSNP:1053123"
variation 1845
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="c"
/replace="t"
/db_xref="dbSNP:1053150"
variation 1867
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="a"
/replace="c"
/db_xref="dbSNP:1053158"
variation 1876
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="c"
/replace="t"
/db_xref="dbSNP:1053161"
variation 1887
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="a"
/replace="g"
/db_xref="dbSNP:1053163"
variation 1940
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="c"
/replace="t"
/db_xref="dbSNP:1053170"
variation 1963
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
/replace="c"
/replace="g"
/db_xref="dbSNP:1053172"
polyA_signal 2035..2040
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
polyA_site 2052
/gene="RBMX"
/gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
RNMX"
ORIGIN
ggtccttcagcctcgttcccgggcagtataaagtttgctgtctcctttgttcgccctcgttgcgcagtagtgctagcggcttcgcggttcggtcctcgcacccggcagccgccactggtgctgagctgctaggaagcccctatcgccgagctcgttggagcttgaacccattgtcacccctccgactcaccggcccaaaaaaaaaaaaacatggttgaagcagatcgcccaggaaagctcttcattggtgggcttaatacggaaacaaatgagaaagctcttgaagcagtatttggcaaatatggacgaatagtggaagtactcttgatgaaagaccgtgaaaccaacaaatcaagaggatttgcttttgtcacctttgaaagcccagcagacgctaaggatgcagccagagacatgaatggaaagctcctgtatcacgtggaagagatagttatggaggtccacctcgaagggaaccgctgccctctcgtagagatgtttatttgtccccaagagatgatgggtattctactaaagacagctattcaagcagagattacccaagttctcgtgatactagagattatgcaccaccaccacgagattatacttaccgtgattatggtcattccagttcacgtgatgactatccatcaagaggatatagcgatagagatggatatggtcgtgatcgtgactattcagatcatccaagtggaggttcctacagagattcatatgagagttatggttggtgattttgctcattatggtcgtggagtgctgattgattcacagtagataaagctggcagtaagaaatgctaagagttgttgaagcagaaggcggctgattgtcaataagtcactacagttgcataagcagtgctgtcagaattggtttggtgcaggcaatagattttgccttcaggggttcctgtggatctgaggaaggcatcagtgttgattaacactcataactagggagtgactggtagttacttaaagcaagtaattgaccaaatggaaaaggggaagtaattaaggaaattggtaagtggaggtagtcaggaagttcttgtggttcttcacatagattttacagctttggctttcattttgtttagctaaagtcatggggacaactcttcaatttagaacttaagttgaattataaaaatgatggatataagtggtagctgtatctagtgaagtgtctgtcagtaagtgaaacattttttggtggtggcttatccacaaacagtttagttgtagaataaaacttatgagtgacatctggaaagtaaccatgctaagatggcaagcacactggaaacaattaggccacttggctttcttttgctgtattgttttataagcctactttacctcccagtcttggaaacaagttttagttttttattggtttggagactagagccaatagtataatgttctcaaaggaaacagacttgagttgttggattagaggaactaacccaacttatatgattttttttttgtttttgtcgtgtagttatggcactgtcttatttggaacatttgcaactagggataatacaacatttttaactctcatttgacaacctactactaatcacagaccacaagggtaatgaccaaatttatgtggtttttgcactccatagttgtcttagcccaatctttctatactcttacgattacttgggttaacgcttctgtgaggaccttctggctcttgagataccctaaatatttaagatatttagatatcttgaagatagtataggatatagagattgtaccaaataggaatataaggagtatgttaaaatgaccagatacctgtttgatagtttactgacctagcagatgtgtggaaaaggaatcagatcttgattcttctgggtttatactggttgtaaaacagaatgatacagaaaatgttttccttgtttaactggtagttgaacatagaacttgggtattatagatcacttttcactttttggaatgttttgtattgaaacttaataaaactttaacatggaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:27316 -> Molecular function: GO:0000166 [nucleotide binding] evidence: IEA
GeneID:27316 -> Molecular function: GO:0001047 [core promoter binding] evidence: IDA
GeneID:27316 -> Molecular function: GO:0003682 [chromatin binding] evidence: IDA
GeneID:27316 -> Molecular function: GO:0003723 [RNA binding] evidence: IDA
GeneID:27316 -> Molecular function: GO:0003723 [RNA binding] evidence: NAS
GeneID:27316 -> Molecular function: GO:0003729 [mRNA binding] evidence: IDA
GeneID:27316 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:27316 -> Biological process: GO:0000381 [regulation of alternative mRNA splicing, via spliceosome] evidence: IDA
GeneID:27316 -> Biological process: GO:0000398 [mRNA splicing, via spliceosome] evidence: IC
GeneID:27316 -> Biological process: GO:0000398 [mRNA splicing, via spliceosome] evidence: TAS
GeneID:27316 -> Biological process: GO:0006366 [transcription from RNA polymerase II promoter] evidence: IDA
GeneID:27316 -> Biological process: GO:0006509 [membrane protein ectodomain proteolysis] evidence: IDA
GeneID:27316 -> Biological process: GO:0008380 [RNA splicing] evidence: TAS
GeneID:27316 -> Biological process: GO:0010467 [gene expression] evidence: TAS
GeneID:27316 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IDA
GeneID:27316 -> Biological process: GO:0048025 [negative regulation of mRNA splicing, via spliceosome] evidence: ISS
GeneID:27316 -> Biological process: GO:0048026 [positive regulation of mRNA splicing, via spliceosome] evidence: ISS
GeneID:27316 -> Biological process: GO:0051260 [protein homooligomerization] evidence: ISS
GeneID:27316 -> Biological process: GO:0071347 [cellular response to interleukin-1] evidence: IDA
GeneID:27316 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:27316 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:27316 -> Cellular component: GO:0005719 [nuclear euchromatin] evidence: IDA
GeneID:27316 -> Cellular component: GO:0044530 [supraspliceosomal complex] evidence: IDA
GeneID:27316 -> Cellular component: GO:0070062 [extracellular vesicular exosome] evidence: IDA
GeneID:27316 -> Cellular component: GO:0071013 [catalytic step 2 spliceosome] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.