Home |
Help |
Advanced search
2025-05-09 18:47:32, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_003818 9323 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens CDP-diacylglycerol synthase (phosphatidate
cytidylyltransferase) 2 (CDS2), mRNA.
ACCESSION NM_003818
VERSION NM_003818.3 GI:334085265
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 9323)
AUTHORS Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V.,
Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
CONSRTM DREAM investigators
TITLE Variation at the NFATC2 locus increases the risk of
thiazolidinedione-induced edema in the Diabetes REduction
Assessment with ramipril and rosiglitazone Medication (DREAM) study
JOURNAL Diabetes Care 33 (10), 2250-2253 (2010)
PUBMED 20628086
REMARK GeneRIF: Observational study of gene-disease association,
gene-environment interaction, and pharmacogenomic / toxicogenomic.
(HuGE Navigator)
REFERENCE 2 (bases 1 to 9323)
AUTHORS Talmud,P.J., Drenos,F., Shah,S., Shah,T., Palmen,J., Verzilli,C.,
Gaunt,T.R., Pallas,J., Lovering,R., Li,K., Casas,J.P., Sofat,R.,
Kumari,M., Rodriguez,S., Johnson,T., Newhouse,S.J., Dominiczak,A.,
Samani,N.J., Caulfield,M., Sever,P., Stanton,A., Shields,D.C.,
Padmanabhan,S., Melander,O., Hastie,C., Delles,C., Ebrahim,S.,
Marmot,M.G., Smith,G.D., Lawlor,D.A., Munroe,P.B., Day,I.N.,
Kivimaki,M., Whittaker,J., Humphries,S.E. and Hingorani,A.D.
CONSRTM ASCOT investigators; NORDIL investigators; BRIGHT Consortium
TITLE Gene-centric association signals for lipids and apolipoproteins
identified via the HumanCVD BeadChip
JOURNAL Am. J. Hum. Genet. 85 (5), 628-642 (2009)
PUBMED 19913121
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 3 (bases 1 to 9323)
AUTHORS Halford,S., Inglis,S., Gwilliam,R., Spencer,P., Mohamed,M.,
Ebenezer,N.D. and Hunt,D.M.
TITLE Genomic organization of human CDS2 and evaluation as a candidate
gene for corneal hereditary endothelial dystrophy 2 on chromosome
20p13
JOURNAL Exp. Eye Res. 75 (5), 619-623 (2002)
PUBMED 12457874
REFERENCE 4 (bases 1 to 9323)
AUTHORS Deloukas,P., Matthews,L.H., Ashurst,J., Burton,J., Gilbert,J.G.,
Jones,M., Stavrides,G., Almeida,J.P., Babbage,A.K., Bagguley,C.L.,
Bailey,J., Barlow,K.F., Bates,K.N., Beard,L.M., Beare,D.M.,
Beasley,O.P., Bird,C.P., Blakey,S.E., Bridgeman,A.M., Brown,A.J.,
Buck,D., Burrill,W., Butler,A.P., Carder,C., Carter,N.P.,
Chapman,J.C., Clamp,M., Clark,G., Clark,L.N., Clark,S.Y.,
Clee,C.M., Clegg,S., Cobley,V.E., Collier,R.E., Connor,R.,
Corby,N.R., Coulson,A., Coville,G.J., Deadman,R., Dhami,P.,
Dunn,M., Ellington,A.G., Frankland,J.A., Fraser,A., French,L.,
Garner,P., Grafham,D.V., Griffiths,C., Griffiths,M.N., Gwilliam,R.,
Hall,R.E., Hammond,S., Harley,J.L., Heath,P.D., Ho,S., Holden,J.L.,
Howden,P.J., Huckle,E., Hunt,A.R., Hunt,S.E., Jekosch,K.,
Johnson,C.M., Johnson,D., Kay,M.P., Kimberley,A.M., King,A.,
Knights,A., Laird,G.K., Lawlor,S., Lehvaslaiho,M.H., Leversha,M.,
Lloyd,C., Lloyd,D.M., Lovell,J.D., Marsh,V.L., Martin,S.L.,
McConnachie,L.J., McLay,K., McMurray,A.A., Milne,S., Mistry,D.,
Moore,M.J., Mullikin,J.C., Nickerson,T., Oliver,K., Parker,A.,
Patel,R., Pearce,T.A., Peck,A.I., Phillimore,B.J.,
Prathalingam,S.R., Plumb,R.W., Ramsay,H., Rice,C.M., Ross,M.T.,
Scott,C.E., Sehra,H.K., Shownkeen,R., Sims,S., Skuce,C.D.,
Smith,M.L., Soderlund,C., Steward,C.A., Sulston,J.E., Swann,M.,
Sycamore,N., Taylor,R., Tee,L., Thomas,D.W., Thorpe,A., Tracey,A.,
Tromans,A.C., Vaudin,M., Wall,M., Wallis,J.M., Whitehead,S.L.,
Whittaker,P., Willey,D.L., Williams,L., Williams,S.A., Wilming,L.,
Wray,P.W., Hubbard,T., Durbin,R.M., Bentley,D.R., Beck,S. and
Rogers,J.
TITLE The DNA sequence and comparative analysis of human chromosome 20
JOURNAL Nature 414 (6866), 865-871 (2001)
PUBMED 11780052
REFERENCE 5 (bases 1 to 9323)
AUTHORS Volta,M., Bulfone,A., Gattuso,C., Rossi,E., Mariani,M.,
Consalez,G.G., Zuffardi,O., Ballabio,A., Banfi,S. and Franco,B.
TITLE Identification and characterization of CDS2, a mammalian homolog of
the Drosophila CDP-diacylglycerol synthase gene
JOURNAL Genomics 55 (1), 68-77 (1999)
PUBMED 9889000
REFERENCE 6 (bases 1 to 9323)
AUTHORS Halford,S., Dulai,K.S., Daw,S.C., Fitzgibbon,J. and Hunt,D.M.
TITLE Isolation and chromosomal localization of two human
CDP-diacylglycerol synthase (CDS) genes
JOURNAL Genomics 54 (1), 140-144 (1998)
PUBMED 9806839
REFERENCE 7 (bases 1 to 9323)
AUTHORS Lykidis,A., Jackson,P.D., Rock,C.O. and Jackowski,S.
TITLE The role of CDP-diacylglycerol synthetase and phosphatidylinositol
synthase activity levels in the regulation of cellular
phosphatidylinositol content
JOURNAL J. Biol. Chem. 272 (52), 33402-33409 (1997)
PUBMED 9407135
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BP353230.1, AK315489.1 and
AL121755.23.
On May 26, 2011 this sequence version replaced gi:22035625.
Summary: Breakdown products of phosphoinositides are ubiquitous
second messengers that function downstream of many G
protein-coupled receptors and tyrosine kinases regulating cell
growth, calcium metabolism, and protein kinase C activity. This
gene encodes an enzyme which regulates the amount of
phosphatidylinositol available for signaling by catalyzing the
conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme
is an integral membrane protein localized to two subcellular
domains, the matrix side of the inner mitochondrial membrane where
it is thought to be involved in the synthesis of
phosphatidylglycerol and cardiolipin and the cytoplasmic side of
the endoplasmic reticulum where it functions in
phosphatidylinositol biosynthesis. Two genes encoding this enzyme
have been identified in humans, one mapping to human chromosome
4q21 and a second to 20p13. [provided by RefSeq, Jul 2008].
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
##Evidence-Data-START##
Transcript exon combination :: Y16521.1, AK027695.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-19 BP353230.1 1-19
20-1670 AK315489.1 1-1651
1671-9323 AL121755.23 17645-25297
FEATURES Location/Qualifiers
source 1..9323
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="20"
/map="20p13"
gene 1..9323
/gene="CDS2"
/note="CDP-diacylglycerol synthase (phosphatidate
cytidylyltransferase) 2"
/db_xref="GeneID:8760"
/db_xref="HGNC:1801"
/db_xref="HPRD:09150"
/db_xref="MIM:603549"
exon 1..389
/gene="CDS2"
/inference="alignment:Splign:1.39.8"
misc_feature 189..191
/gene="CDS2"
/note="upstream in-frame stop codon"
variation 226..227
/gene="CDS2"
/replace=""
/replace="gggcg"
/db_xref="dbSNP:11466986"
variation 227..228
/gene="CDS2"
/replace=""
/replace="gggcg"
/db_xref="dbSNP:34266571"
variation 231..232
/gene="CDS2"
/replace=""
/replace="ggggc"
/db_xref="dbSNP:71944688"
variation 235..236
/gene="CDS2"
/replace=""
/replace="cgggg"
/db_xref="dbSNP:72270942"
variation 238..239
/gene="CDS2"
/replace=""
/replace="ggcgg"
/db_xref="dbSNP:67020207"
variation 240..241
/gene="CDS2"
/replace=""
/replace="ggggc"
/db_xref="dbSNP:59606548"
variation 283
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:113493863"
CDS 333..1670
/gene="CDS2"
/EC_number="2.7.7.41"
/note="CDP-diglyceride synthetase 2; CDP-diglyceride
pyrophosphorylase 2; CDP-diglyceride diphosphorylase 2;
CDP-DAG synthase 2; CDP-DG synthetase 2; CTP:phosphatidate
cytidylyltransferase 2; CDP-diacylglycerol synthase 2; CDS
2; CDP-DG synthase 2; CDP-diglyceride synthase 2"
/codon_start=1
/product="phosphatidate cytidylyltransferase 2"
/protein_id="NP_003809.1"
/db_xref="GI:20143480"
/db_xref="CCDS:CCDS13088.1"
/db_xref="GeneID:8760"
/db_xref="HGNC:1801"
/db_xref="HPRD:09150"
/db_xref="MIM:603549"
/translation="
MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLRSHLIDKGMLTSTTEDE
"
misc_feature 393..395
/gene="CDS2"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(O95674.1); phosphorylation site"
misc_feature 393..395
/gene="CDS2"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 429..431
/gene="CDS2"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(O95674.1); phosphorylation site"
misc_feature 435..437
/gene="CDS2"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(O95674.1); phosphorylation site"
misc_feature 441..443
/gene="CDS2"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(O95674.1); phosphorylation site"
misc_feature 567..629
/gene="CDS2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (O95674.1);
transmembrane region"
misc_feature 648..1607
/gene="CDS2"
/note="Cytidylyltransferase family; Region: CTP_transf_1;
cl00347"
/db_xref="CDD:185926"
misc_feature 726..788
/gene="CDS2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (O95674.1);
transmembrane region"
misc_feature 828..890
/gene="CDS2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (O95674.1);
transmembrane region"
misc_feature 969..1031
/gene="CDS2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (O95674.1);
transmembrane region"
misc_feature 1116..1178
/gene="CDS2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (O95674.1);
transmembrane region"
misc_feature 1350..1412
/gene="CDS2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (O95674.1);
transmembrane region"
exon 390..526
/gene="CDS2"
/inference="alignment:Splign:1.39.8"
variation 407
/gene="CDS2"
/replace="a"
/replace="c"
/db_xref="dbSNP:5013472"
variation 441
/gene="CDS2"
/replace="a"
/replace="t"
/db_xref="dbSNP:373151186"
variation 455
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:372748731"
variation 456
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:150527816"
variation 458
/gene="CDS2"
/replace="a"
/replace="c"
/db_xref="dbSNP:138251157"
variation 526
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:375638808"
exon 527..623
/gene="CDS2"
/inference="alignment:Splign:1.39.8"
variation 567
/gene="CDS2"
/replace=""
/replace="a"
/db_xref="dbSNP:35315800"
variation 623
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:140103955"
exon 624..721
/gene="CDS2"
/inference="alignment:Splign:1.39.8"
variation 627
/gene="CDS2"
/replace="a"
/replace="t"
/db_xref="dbSNP:118058125"
variation 633
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:370528801"
variation 713
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:145582118"
exon 722..861
/gene="CDS2"
/inference="alignment:Splign:1.39.8"
variation 755
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:375500781"
variation 776
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:200304958"
variation 785
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:368516080"
exon 862..920
/gene="CDS2"
/inference="alignment:Splign:1.39.8"
variation 878
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:35796695"
variation 903
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:201613534"
exon 921..1003
/gene="CDS2"
/inference="alignment:Splign:1.39.8"
variation 951
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:149850561"
exon 1004..1091
/gene="CDS2"
/inference="alignment:Splign:1.39.8"
variation 1007
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:200494742"
variation 1020
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:112055575"
variation 1025
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:201506899"
variation 1061
/gene="CDS2"
/replace="a"
/replace="c"
/db_xref="dbSNP:149118554"
variation 1075
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:143175887"
variation 1079
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:368700421"
exon 1092..1160
/gene="CDS2"
/inference="alignment:Splign:1.39.8"
variation 1097
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:148918269"
variation 1106
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:3818196"
variation 1147
/gene="CDS2"
/replace="a"
/replace="t"
/db_xref="dbSNP:372946609"
exon 1161..1313
/gene="CDS2"
/inference="alignment:Splign:1.39.8"
variation 1178
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:111727857"
variation 1263
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:146586086"
variation 1285..1286
/gene="CDS2"
/replace=""
/replace="c"
/db_xref="dbSNP:34055146"
variation 1312
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:141290228"
exon 1314..1433
/gene="CDS2"
/inference="alignment:Splign:1.39.8"
variation 1318
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:144822618"
variation 1320
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:138666853"
variation 1322
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:372404549"
variation 1323
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:376439839"
variation 1331
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:370998735"
variation 1352
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:150695888"
variation 1400
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:34096549"
exon 1434..1537
/gene="CDS2"
/inference="alignment:Splign:1.39.8"
variation 1448
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:201496221"
exon 1538..9323
/gene="CDS2"
/inference="alignment:Splign:1.39.8"
variation 1582
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:137924546"
variation 1598
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:370172531"
variation 1616
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:149449414"
variation 1618
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:143859713"
variation 1620
/gene="CDS2"
/replace="g"
/replace="t"
/db_xref="dbSNP:200238442"
variation 1631
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:138757559"
variation 1634
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:373419561"
variation 1664
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:147360412"
variation 1673
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:370840326"
variation 1675
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:373995252"
variation 1696
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:202125562"
variation 1698
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:377586394"
variation 1701
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:370518772"
variation 1719
/gene="CDS2"
/replace="g"
/replace="t"
/db_xref="dbSNP:201416938"
variation 1777
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:79005883"
variation 1782
/gene="CDS2"
/replace=""
/replace="t"
/db_xref="dbSNP:11477708"
variation 1795
/gene="CDS2"
/replace="g"
/replace="t"
/db_xref="dbSNP:77534359"
variation 1856..1857
/gene="CDS2"
/replace=""
/replace="tg"
/db_xref="dbSNP:148444736"
variation 1857..1858
/gene="CDS2"
/replace=""
/replace="gt"
/db_xref="dbSNP:376747167"
polyA_site 1893
/gene="CDS2"
STS 1938..2815
/gene="CDS2"
/standard_name="CDS2_8852"
/db_xref="UniSTS:467598"
variation 1955
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:3746676"
variation 1970
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:370213630"
variation 2009
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:373120596"
variation 2012
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:372714470"
variation 2255
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:16990718"
variation 2314
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:192605496"
variation 2319
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:377160221"
variation 2333
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:139435606"
variation 2416
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:370375427"
variation 2458
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:185604094"
variation 2496
/gene="CDS2"
/replace="a"
/replace="c"
/db_xref="dbSNP:145170759"
variation 2572
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:73586501"
STS 2600..2700
/gene="CDS2"
/standard_name="RH18488"
/db_xref="UniSTS:40994"
polyA_site 2613
/gene="CDS2"
variation 2645
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:143949213"
STS 2655..2743
/gene="CDS2"
/standard_name="RH28677"
/db_xref="UniSTS:86274"
variation 2724
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:148664719"
polyA_signal 2756..2761
/gene="CDS2"
variation 2772
/gene="CDS2"
/replace="a"
/replace="t"
/db_xref="dbSNP:112348943"
variation 2776
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:113927874"
polyA_site 2779
/gene="CDS2"
variation 2803
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:6116683"
variation 2811
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:192957660"
variation 2824
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:3746677"
variation 2851
/gene="CDS2"
/replace=""
/replace="t"
/db_xref="dbSNP:368483864"
variation 2858..2859
/gene="CDS2"
/replace=""
/replace="t"
/db_xref="dbSNP:3833325"
variation 2902
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:151226067"
variation 2950
/gene="CDS2"
/replace="g"
/replace="t"
/db_xref="dbSNP:376154035"
variation 2970
/gene="CDS2"
/replace="a"
/replace="t"
/db_xref="dbSNP:184515327"
variation 2973
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:188840903"
variation 3025
/gene="CDS2"
/replace="a"
/replace="t"
/db_xref="dbSNP:77805175"
variation 3034
/gene="CDS2"
/replace="g"
/replace="t"
/db_xref="dbSNP:181309279"
variation 3072
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:6116684"
variation 3088
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:374504723"
variation 3098
/gene="CDS2"
/replace="a"
/replace="t"
/db_xref="dbSNP:113805579"
variation 3194
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:6085025"
variation 3212
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:140379455"
variation 3228..3229
/gene="CDS2"
/replace=""
/replace="c"
/db_xref="dbSNP:35911658"
variation 3260
/gene="CDS2"
/replace="a"
/replace="c"
/db_xref="dbSNP:16990725"
variation 3262
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:368055426"
variation 3282
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:144141819"
variation 3290
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:146799297"
variation 3359
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:117556296"
variation 3501
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:183986023"
variation 3519
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:140508849"
variation 3541
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:2295510"
variation 3632
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:150430322"
variation 3637
/gene="CDS2"
/replace="a"
/replace="c"
/db_xref="dbSNP:189261022"
variation 3739
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:34915502"
variation 3786
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:149196199"
variation 3796..3797
/gene="CDS2"
/replace=""
/replace="g"
/db_xref="dbSNP:201362541"
variation 3797..3798
/gene="CDS2"
/replace=""
/replace="g"
/db_xref="dbSNP:72474918"
variation 3798..3804
/gene="CDS2"
/replace="cggggtc"
/replace="gggggtca"
/db_xref="dbSNP:71339308"
variation 3798
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:6133193"
variation 3802
/gene="CDS2"
/replace="g"
/replace="t"
/db_xref="dbSNP:77407209"
variation 3803
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:75789066"
variation 3804..3805
/gene="CDS2"
/replace=""
/replace="a"
/db_xref="dbSNP:11376563"
variation 3804
/gene="CDS2"
/replace="a"
/replace="c"
/db_xref="dbSNP:79995762"
variation 3805..3806
/gene="CDS2"
/replace=""
/replace="a"
/db_xref="dbSNP:71658859"
variation 3825
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:180751229"
variation 3856
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:78604961"
variation 3978
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:143328476"
variation 4003
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:114773445"
variation 4011
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:187362634"
variation 4024
/gene="CDS2"
/replace="a"
/replace="c"
/db_xref="dbSNP:148345903"
variation 4060
/gene="CDS2"
/replace=""
/replace="t"
/db_xref="dbSNP:71785622"
variation 4061..4062
/gene="CDS2"
/replace=""
/replace="t"
/db_xref="dbSNP:71696033"
polyA_signal 4079..4084
/gene="CDS2"
polyA_site 4101
/gene="CDS2"
variation 4168
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:2295511"
variation 4262
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:17785402"
variation 4263
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:112593797"
variation 4396
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:192206395"
variation 4400
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:115679878"
variation 4413
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:147533038"
variation 4427
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:117040381"
variation 4457
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:181714474"
variation 4599
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:185897318"
variation 4606
/gene="CDS2"
/replace="g"
/replace="t"
/db_xref="dbSNP:371569910"
variation 4773
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:137952466"
variation 4783
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:118074285"
variation 4811
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:190308096"
variation 4820
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:143368283"
variation 4829
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:6053188"
variation 4832
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:182595893"
variation 5019
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:73588505"
variation 5056
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:372776920"
variation 5072
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:150538331"
variation 5079
/gene="CDS2"
/replace="a"
/replace="t"
/db_xref="dbSNP:372483093"
variation 5187
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:139496708"
variation 5190
/gene="CDS2"
/replace="g"
/replace="t"
/db_xref="dbSNP:377233101"
variation 5206
/gene="CDS2"
/replace="a"
/replace="c"
/db_xref="dbSNP:374812206"
variation 5213
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:4815770"
variation 5214
/gene="CDS2"
/replace="a"
/replace="t"
/db_xref="dbSNP:149724972"
variation 5255
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:186870509"
variation 5357
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:190916180"
variation 5365
/gene="CDS2"
/replace="g"
/replace="t"
/db_xref="dbSNP:182741081"
variation 5389
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:144562972"
variation 5390
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:6038088"
variation 5411
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:188957351"
variation 5553..5554
/gene="CDS2"
/replace=""
/replace="cct"
/db_xref="dbSNP:139019564"
variation 5554..5555
/gene="CDS2"
/replace=""
/replace="cct"
/db_xref="dbSNP:377550963"
variation 5589
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:139296325"
variation 5717
/gene="CDS2"
/replace="g"
/replace="t"
/db_xref="dbSNP:193242913"
variation 5771
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:6116685"
variation 5837
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:184760821"
variation 5845
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:73893915"
variation 5865
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:187528369"
variation 5966
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:114672710"
variation 6027
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:732817"
variation 6072
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:78660111"
variation 6073
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:79181201"
variation 6092
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:146502839"
variation 6105
/gene="CDS2"
/replace="a"
/replace="c"
/db_xref="dbSNP:114650868"
variation 6163
/gene="CDS2"
/replace="g"
/replace="t"
/db_xref="dbSNP:192047611"
variation 6246
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:79341417"
variation 6272
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:184235050"
variation 6282
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:189795796"
variation 6299
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:140522342"
variation 6333
/gene="CDS2"
/replace="a"
/replace="c"
/db_xref="dbSNP:6085026"
variation 6344
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:180993113"
variation 6409
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:142763591"
variation 6464
/gene="CDS2"
/replace="a"
/replace="t"
/db_xref="dbSNP:184471908"
variation 6551
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:151069492"
variation 6580
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:115832519"
variation 6594
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:111535554"
variation 6680
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:141007361"
variation 6748..6750
/gene="CDS2"
/replace=""
/replace="cct"
/db_xref="dbSNP:138570405"
variation 6784
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:150215830"
variation 6841
/gene="CDS2"
/replace="a"
/replace="t"
/db_xref="dbSNP:147940319"
variation 6917
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:113318278"
variation 6939
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:190555979"
variation 6999
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:62200450"
variation 7014
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:200274819"
variation 7024
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:111861880"
variation 7070..7071
/gene="CDS2"
/replace=""
/replace="c"
/db_xref="dbSNP:34130515"
variation 7193
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:147114585"
variation 7229
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:181883591"
variation 7230
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:186138421"
variation 7268
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:8184346"
variation 7334
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:369214363"
variation 7383
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:138514359"
variation 7403
/gene="CDS2"
/replace="c"
/replace="g"
/db_xref="dbSNP:190550970"
variation 7412
/gene="CDS2"
/replace="a"
/replace="c"
/db_xref="dbSNP:143434074"
variation 7416
/gene="CDS2"
/replace="g"
/replace="t"
/db_xref="dbSNP:12624765"
variation 7457
/gene="CDS2"
/replace="a"
/replace="t"
/db_xref="dbSNP:6107592"
variation 7563
/gene="CDS2"
/replace="g"
/replace="t"
/db_xref="dbSNP:181476298"
variation 7626
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:143012076"
variation 7640
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:73588512"
variation 7690
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:114347250"
variation 7706
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:148187692"
variation 7722
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:370686814"
variation 7732
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:186478894"
variation 7738
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:191407200"
variation 7805
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:76937866"
variation 7872
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:182723727"
variation 7902
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:187908021"
variation 7913
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:374430411"
variation 8042
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:116811504"
variation 8123
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:190603181"
variation 8131
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:112972504"
variation 8229
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:112568411"
variation 8283
/gene="CDS2"
/replace="g"
/replace="t"
/db_xref="dbSNP:77435581"
variation 8436
/gene="CDS2"
/replace="a"
/replace="c"
/db_xref="dbSNP:187759246"
variation 8462
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:141226154"
variation 8465
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:17179149"
variation 8571
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:150744336"
variation 8653
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:73588514"
variation 8670..8673
/gene="CDS2"
/replace=""
/replace="tttt"
/db_xref="dbSNP:369358087"
variation 8670
/gene="CDS2"
/replace=""
/replace="t"
/db_xref="dbSNP:11479516"
variation 8683..8685
/gene="CDS2"
/replace=""
/replace="t"
/db_xref="dbSNP:375764367"
variation 8683
/gene="CDS2"
/replace="g"
/replace="t"
/db_xref="dbSNP:370640072"
variation 8685
/gene="CDS2"
/replace="g"
/replace="t"
/db_xref="dbSNP:58233176"
variation 8685
/gene="CDS2"
/replace=""
/replace="t"
/replace="ttt"
/replace="tttt"
/db_xref="dbSNP:71197755"
variation 8686..8687
/gene="CDS2"
/replace=""
/replace="gg"
/db_xref="dbSNP:372486768"
variation 8687
/gene="CDS2"
/replace="g"
/replace="t"
/db_xref="dbSNP:60990164"
variation 8700..8701
/gene="CDS2"
/replace=""
/replace="a"
/replace="t"
/db_xref="dbSNP:62859362"
variation 8826
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:192303776"
variation 8869..8871
/gene="CDS2"
/replace=""
/replace="cc"
/db_xref="dbSNP:200774815"
variation 8870..8871
/gene="CDS2"
/replace=""
/replace="ct"
/db_xref="dbSNP:139068511"
variation 8872..8873
/gene="CDS2"
/replace=""
/replace="ct"
/db_xref="dbSNP:71791375"
variation 9023
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:182967855"
variation 9040
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:62200451"
variation 9145
/gene="CDS2"
/replace="a"
/replace="g"
/db_xref="dbSNP:375537545"
variation 9146
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:188170671"
variation 9185
/gene="CDS2"
/replace="c"
/replace="t"
/db_xref="dbSNP:139309460"
variation 9259
/gene="CDS2"
/replace="a"
/replace="c"
/db_xref="dbSNP:142519884"
polyA_signal 9302..9307
/gene="CDS2"
variation 9320
/gene="CDS2"
/replace="a"
/replace="t"
/db_xref="dbSNP:3746678"
variation 9321
/gene="CDS2"
/replace="a"
/replace="c"
/db_xref="dbSNP:146035656"
polyA_site 9323
/gene="CDS2"
ORIGIN
atttgcgccattggtggatattccggaccgtgatggtggcgctgcgcgtgcgcactcgctccgagccctgctcccgggagagggagctctcgggtcggggctagggaaggctgaccccgctcggcccgggtgaaagggcggtgacggcactgggtggggccgagctccagggctggctgctgggctgctaagggaactgtgagccgctcagagccgcgcgcctcccgggcggggcggggccggccgtgggagtccgcgcgtgcccgcgccgagctgcctgctccggcggcttcgctgctagctcgcggcgacgtcgggccgattttcccaggatgacagagctgaggcagagggtggcccatgagccggttgcgccacccgaggacaaggagtcagagtcagaagcaaaggtagatggagagactgcatcggacagtgagagccgggcagaatccgcacccctgccagtctctgcagatgataccccggaggtcctcaatagggccctttccaacttgtcttcaagatggaagaactggtgggtgagaggcatcctgactttggccatgattgcatttttcttcatcatcatttacctgggaccaatggttttgatgataatcgtgatgtgcgttcagattaagtgtttccatgagataatcactattggctacaacgtctaccactcatatgatctgccctggttcaggacgctcagctggtactttctcctgtgtgtaaactatttcttctatggtgagacagtgacggattacttcttcaccctggtccagagagaagagcctttgcggattctcagtaaataccaccggttcatttcctttactctctatctaataggattctgcatgtttgtactgagtctggtcaagaagcattatcgactgcagttctacatgtttggctggacccatgtgacattgctgattgttgtaacacagtcacatcttgttatccacaacctatttgaaggaatgatctggttcattgtccccatatcttgtgtgatctgtaatgacatcatggcctatatgtttggctttttctttggtcggaccccactcatcaagctgtccccgaagaagacctgggaaggcttcattgggggcttctttgctactgtggtgtttggccttctgctgtcctatgtgatgtccgggtacagatgctttgtctgccctgtggagtacaacaatgacaccaacagcttcactgtggactgtgagccctcggacctgtttcgcctgcaggagtacaacattcctggggtgatccagtcagtcattggctggaaaacggtccggatgtaccccttccagattcacagcatcgctctctccacctttgcctcgctcattggcccctttggaggattcttcgcaagtggattcaaacgagcctttaaaatcaaagactttgccaataccattcctggccatggaggcatcatggatcgctttgactgccagtatctgatggccacctttgtcaatgtatacatcgccagttttatcagaggccctaacccaagcaaactgattcagcagttcctgactttacggccagatcagcagctccacatcttcaacacgctgcggtctcatctgatcgacaaagggatgctgacatccaccacagaggacgagtaggggccacccagggccaggagaacaggaacagaactgagcaggggcaggtctccaaggcaagcccagctggtgtgacttagacaatgacgaggcttcaactcactgtcttttttttttttttttggagggtattttttatttgtgggttcaaaaaatctgtatatacagtctatgtgtttagaatttgtgttgtaagtaaactacagctttgagttggaaagaagtcacgggttgtaaaaccatttggatttttttaaaacaaaagtattaataatctggaagacagtgttgcccaggtcaggagtgttttcttggtggttccagcccccatcaattgaactgtttctgggctcagtcagacacagacattcatctgtgtctgaccaaatcaggggacttccccacctgtggtgggaggcacagcttagatgttttgtacacctggtcttttctagaaatccctgcttggagctgcagaagggttgccttctgtaggtcggaggaatggaggcttactaaccaggtaagccttctatgcatccacaccaaaatcctgcagaatgtaagtaagctctgctttataagatgggttcaccttcatcgcagactgaaagtttcagtttttatttttttcagaaagcacgaaaaattatttataatagtctggagaaaaaacacactgtaatatttcaagtgtatgcagtagaatgtactgtaactgagccctttcccacatgtctaggctccaatgtctcctgtaggtccacctaactgtgtgttttcagggacaatgccatccatgtttgtgctgtagacttgctgctgctgaatcctttctggggactttctcatcgggcagggagcagagggcttctcgttcatgcaccctttgcctgaacacccatgtagctgctgtgttgtgtatatattactcttaagaggagtgtgtgtgtctgtgtttgttttaaaagtcacttatttcttacagtgatttcaattgcaccatgacttcttcactaaaaccacaaagtcctgcttaaaactatggaaaacctaacctgattagagccttgactattttgaagattaaatgcacactttttatataatgtgaccagtttaaatgtagtttgtattgtactgggggacctttcgttgttgttgtttgcttaaactgtgattttttttcccctccctaatttcaggggtgagattgactttgggaagacagattagttctttgtcaggccaacaagtgatggagtgcgggagagagaacttggcacccaaatatatcaaactattccgtgccgtggatgttttcattgccaacgagggtgtaatgatttgcttctgcaccttggtctagtgctggtttgtggtgtttttgtttgtaaattagcctcactgcctccctgaaagtgcacagtcagcccaggtctctagagtgtccagcagaggatggagccctcgggatgtttcagctcacacatccttgagtgacttcccatatgtgtgtggggctgaagcggcttctttccgctgaacttttatttccatttcagcctcgtggcttctcttattcaggtccaaggccccttaaaaacaaaacatattatcgcaagggctttcatttcagtattggctgtgtcactggcaggatgcatcactctccagggcctctttttcggagctactcccaattccactcttctgtgattctggctgagcaagttcatgccggtagaggctcattaagtgaggtcctgggcaccccccaaacaggaagtgttttcaggcccttacatgcttatccttaaggtgagtaggtatctcagcagcacacccgaacagtaaaggtgatcaataacgaaactgtagttttcagattgaagaatgaacctggatcaccaaactagataccgaaagggctcctcatttgtctcttttgtcccattgtgggcatatggtgggctccttgagaggagggagtctcagctggggcctggctgcagagacctgctcttgaatagggctgcctttgggatcagggagccgagcatactgggcaaggctcatcatgttcctttgtggaagtggttacttggtgggggtggggtggggaaggggggtctaggaagccgaagctgagtgcgcactagagctgctagcaggcaggccagagggtcagcttgtgttttattttctgatttctcctgcatgctttctggagatgaggattttttgtcaggtagctaggagagcactgccaccttgtgtccatatagcacaatgtttctctttcctattcacagacaagattcaagaaaccatttttacgtgtgtacattcaaatcttcatgaatggcatcacttgctttagacccattttttttttattggtcagaaataaaatgtgactgcaactgtgtgccctcccttgtcgtgaattccctgtttatcacttccatgcatggttttatgcttctcatttgtttatgtattcatgaatactgcatagtcctgattcagagacttttgctttgctttccaacttgtatccctacattctcacaacagccttcttacctcgggtgagagtcatgagcaccttaccaggcagggagcttccccaggatagtgtggtggagtcaggactcactccatcctgcactttacccacaggacacctggagggtcccccagccctgcttgcttttgtgaacgtcgtgtgagtacaccgaggtgttgcagctttccttccctctagctcaggaggcctggcctgagccaggttggagcttaaattgctgttggctcctgcctggtggaacaagggggtcatagaaaccagggctgatgggcaccccccagcccctgggagctctgctcatgaccgctcacagggtaccgagtctttgccttttgtgtgtgcgcatgctgccctcttaactgcttttagtattcagaaaggttccatttatgttttactcctgaaagtgaaaccctcttaggcaacttgtttcatattctgggcattttagtagctacagtattttgcatttaaaatgtaattactcttagtattgtacagccctataatgtatgagaactagtttcacatcctttgaaactaatctctttcattggggaggatacaacttttgactttacacaggtggactttgaatccatttttatagaatttttttccactgtaacttgacctatattatgcaagaaaatcccaaaaatatgttttaagggagactacacagaccttgtgatttggtctgagctagttgctgagttgactggagccttatttgaatggatctttgagttgagatcttcacactgtcagtgagcccttggctcagcccttgtcacctgtttgtatggggaccatgtttcccaaagctcaggttcatctccactattgacagagtcgggtagtgggagagtataagtgacttgagacagagtgtccttgctcagaaaactgtgaagcaggggtcttgttagttacaaagccagtcctagttgcatgtccaagggggtagattttcatcaccctactaaatgtggtatgtcactgctgaagccttttcctgttttagtaatatcttaggcactattgtcttttgtcttccagagtaacatatctgggcccacctttcttgcacactgtgattatgtgctaagaaaagggtggagttgggaggacaatttcacttgaacaggtttctgttcttctgaggtcagggtggggaggatgtccaggtgacttttatggacacattgcaagacagtaagccgcggatggactctcacttgtgctttggaacactggactccaaagagcaggtggaacaaactctggcctgaagatgatggctaatactcaggcagagccccgtattcttccctgacttggtcaaaacaaacttccttttcccttgatcaccctgcacgcagctgcccagcttccagtttttaaagagatgaacagctctcacttcctgactcagtttctcttgttgggtgggggccttgtgccacaacctgcatggggtgctagggtttaaaccaagtggtcacgaaggattcttatctcagggctctgcctggcccaccttctcttgggcctggactctccttatccacatccctgcagaaggtgggccctattctcagaagagtcctggctgctgttgccatctgaatgcgcccttccctttcaggttgaccagcagtggccttacctggcctctcaggtggatggaggctgttctcatctggggctgtctcttgattaaggctgtcacctgtttgtatagggaccatgtttcccaacgcactttgagtgcagtttaggaggtatcctttggatgctgaagtgttgggattttgaggacatgcggatgatttatgagaatagaggggcagagtttgtgaagtctagggttttttgtccagtgggtttcaaatttgttggctgtttaaagaccctgtctcctcccccaccctccccttccttttcccatcaaatgcctacctactgaggcgccttctctttttattcttgagccaatgagatatcagtgtgtttattaataaggattgcaatagtatagtgcttaatatgtgccaggcatagtgctaagggtttacatacgttatcccttttaatccagaaaacagcctttgattaggtattgttgtctccattttatagatgaggaaactgaggcagtatgactgaggccgagagcagtggttaagacagactttgggatcaaatcaccctaggtgcgggcaggtttctaggctgctctaagcttctaccttgaaggcagttgggtctgataatagtaccttcttcctggggtggttgtgaggatataacgaggtaatgcatgtaagcatttagtaccatgcctggcacatagtaagcactcaataaatggtagttacttttgttgagctcagctggtagtttgacctccgttggtgcaatgccagagatgggattgtcagccaccacactgccaccaccctgcacacagtctgggtccctccgagagaagcacgccaaccttaacatcccctacagcatcttggtgcttcacacaccatttaggaggccaccctaacgaggcaagaggacatgggggtgtgcagaagttctgttcttagtgagaatggctggcctgagaatccagctcacctcctctgcccacagtctggactgcttgtgggaaggccatctcctcctgtctggtggtacctccactctgggcagggagggcctgtctgtgactcgctctggaccccacttcccgctctggccaagggctgtcttctgtgcacatagctcaggagcctgcagcagttccctgtatgggtggatgtcctcaggggccaagaagagaagaatggggacaacagaaacctgctttgtaggggattatgtagactaaaagcctagaagttctgcccacatccttatgacgcagccaatctggagcttcatgtttccttctaaaagtagtaaccgggtagaagtgggtgacccattgaggacacatgatgtgaggtatttctgccggattctaggttagcaaagactcaaatgggtgactcatgaatgaagggagaacaggcacaggacttaatgaaaagagtttcttgaacttagttttctgaatgggggtggggagttggggcacgtgtgtgtaaggggaggctgcctcactttgaaggaatggtgttggctaacaggatccatgaaattcctaggtcagttgaataataactgaactactggtttgactgtggattatttcctgggtattagtgggacccaacagcacattgctattaatagtatggaaataatggtccctctgtttcattgaattgctgaagtaatgataatgccatgaaccaggagaagatggttgtgggggtttctaggaagcagctgctgtgacaggccaatcccaggcttgcccccgagccctcctgtccttctgggtttgtgtttgccttgcctggtgcttcctccctcattgtgttgttgaatagacctaggcagccttgtatccatagaaagcctccactgctgggccggggagggggttgtggtaagggccctctggaaatcaagcagagaatgcctttgcagtggtctcccgggcattgggcagggcctagccttttgcagcccccagaggaccttgcctgcataaagcactcagaagggttagccacctggtgattttgtctctagtgaaactgtgtttgccgataatcatccacatagccacctctgtcctcgcagtttggatgcctttttttgacacctgcgctaggttcttgtatgctggcttttcttaaaggaacagcagagtagaaaagaggttgagaatgttttctagcaggcagaatgtgcatacatgttttcatgagtgtcctttgggtgctgtttcttttaaatcctctgtgcacagggctctggcctttagtaaactgtttttctgtcttacgtcatgctgactgggtgctaggggctgattacaaaggggaagagttgaacagacatcaggggccgatgaaaccaaaggactaggagtcaggagaacaagtcagggattaggagacagcggtttggtttattgttatccagctggaggactcctaggggcagcagcaggaggaataccagggccacggaggggccaggagtctcacagtggagggcagactctaacagatgccagctgaacgctcgctggccctggatgtcatacgagttggggaccagaaatctgggctcagagaacccgtccagggagatttgaagccatgggttatcttctagagttgatactgataatatattttaatttttattgatgtttaataccttctgaaacaggagggtaagatcagatgggaagcccctctgttgaaggatcttgggaaccttggtggttttttttttttttttggttttttttttttgatcgagctgtggacatccttcttaattcgattctgaggatttgtttaactaaaaagttcccaaacacagaaagggcctccccacctgctttggggagctgtctgtgctgggagtgccaggcatcccatgggacccatcactgccagtgtctgtgcctcccagaggtcagccgtgtctgccctggctctgtctcctctgtgacagggcagagcatttctggtcagtttctccatggtgcctcccacccctttgtaaagtggatggacatgatggaattcagttgtctcaccctgatagcctgggtgttgatattcactttacccgcactcagacacaggcgaccttgaagcagttctcggtgtgtagagtccacgtgacagtccccacagcctccccagatagctgtgtgcctgtgcgctactgctgtgccattttcccaacttggcgtttcactaaatgcagctgatctctctctctgtgcactcgtgatccatgttgaacaatacatgtaggttctttttccacgcaatgtaagaacatgatatactgtacgttggaaagcatttaccttatttatatacctgaatgttcctactacacaaataaacatatattaaattcta
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:8760 -> Molecular function: GO:0004605 [phosphatidate cytidylyltransferase activity] evidence: NAS
GeneID:8760 -> Biological process: GO:0006644 [phospholipid metabolic process] evidence: TAS
GeneID:8760 -> Biological process: GO:0006655 [phosphatidylglycerol biosynthetic process] evidence: TAS
GeneID:8760 -> Biological process: GO:0008654 [phospholipid biosynthetic process] evidence: NAS
GeneID:8760 -> Biological process: GO:0016024 [CDP-diacylglycerol biosynthetic process] evidence: IEA
GeneID:8760 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
GeneID:8760 -> Biological process: GO:0046474 [glycerophospholipid biosynthetic process] evidence: TAS
GeneID:8760 -> Cellular component: GO:0005743 [mitochondrial inner membrane] evidence: NAS
GeneID:8760 -> Cellular component: GO:0005743 [mitochondrial inner membrane] evidence: TAS
GeneID:8760 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: IEA
GeneID:8760 -> Cellular component: GO:0016021 [integral to membrane] evidence: NAS
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_003809 -> EC 2.7.7.41
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.