Home |
Help |
Advanced search
2025-05-09 18:42:13, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001197238 1820 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens butyrophilin, subfamily 2, member A2 (BTN2A2),
transcript variant 4, mRNA.
ACCESSION NM_001197238
VERSION NM_001197238.1 GI:308522747
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1820)
AUTHORS Shi,J., Levinson,D.F., Duan,J., Sanders,A.R., Zheng,Y., Pe'er,I.,
Dudbridge,F., Holmans,P.A., Whittemore,A.S., Mowry,B.J., Olincy,A.,
Amin,F., Cloninger,C.R., Silverman,J.M., Buccola,N.G.,
Byerley,W.F., Black,D.W., Crowe,R.R., Oksenberg,J.R., Mirel,D.B.,
Kendler,K.S., Freedman,R. and Gejman,P.V.
TITLE Common variants on chromosome 6p22.1 are associated with
schizophrenia
JOURNAL Nature 460 (7256), 753-757 (2009)
PUBMED 19571809
REFERENCE 2 (bases 1 to 1820)
AUTHORS Mungall,A.J., Palmer,S.A., Sims,S.K., Edwards,C.A., Ashurst,J.L.,
Wilming,L., Jones,M.C., Horton,R., Hunt,S.E., Scott,C.E.,
Gilbert,J.G., Clamp,M.E., Bethel,G., Milne,S., Ainscough,R.,
Almeida,J.P., Ambrose,K.D., Andrews,T.D., Ashwell,R.I.,
Babbage,A.K., Bagguley,C.L., Bailey,J., Banerjee,R., Barker,D.J.,
Barlow,K.F., Bates,K., Beare,D.M., Beasley,H., Beasley,O.,
Bird,C.P., Blakey,S., Bray-Allen,S., Brook,J., Brown,A.J.,
Brown,J.Y., Burford,D.C., Burrill,W., Burton,J., Carder,C.,
Carter,N.P., Chapman,J.C., Clark,S.Y., Clark,G., Clee,C.M.,
Clegg,S., Cobley,V., Collier,R.E., Collins,J.E., Colman,L.K.,
Corby,N.R., Coville,G.J., Culley,K.M., Dhami,P., Davies,J.,
Dunn,M., Earthrowl,M.E., Ellington,A.E., Evans,K.A., Faulkner,L.,
Francis,M.D., Frankish,A., Frankland,J., French,L., Garner,P.,
Garnett,J., Ghori,M.J., Gilby,L.M., Gillson,C.J., Glithero,R.J.,
Grafham,D.V., Grant,M., Gribble,S., Griffiths,C., Griffiths,M.,
Hall,R., Halls,K.S., Hammond,S., Harley,J.L., Hart,E.A.,
Heath,P.D., Heathcott,R., Holmes,S.J., Howden,P.J., Howe,K.L.,
Howell,G.R., Huckle,E., Humphray,S.J., Humphries,M.D., Hunt,A.R.,
Johnson,C.M., Joy,A.A., Kay,M., Keenan,S.J., Kimberley,A.M.,
King,A., Laird,G.K., Langford,C., Lawlor,S., Leongamornlert,D.A.,
Leversha,M., Lloyd,C.R., Lloyd,D.M., Loveland,J.E., Lovell,J.,
Martin,S., Mashreghi-Mohammadi,M., Maslen,G.L., Matthews,L.,
McCann,O.T., McLaren,S.J., McLay,K., McMurray,A., Moore,M.J.,
Mullikin,J.C., Niblett,D., Nickerson,T., Novik,K.L., Oliver,K.,
Overton-Larty,E.K., Parker,A., Patel,R., Pearce,A.V., Peck,A.I.,
Phillimore,B., Phillips,S., Plumb,R.W., Porter,K.M., Ramsey,Y.,
Ranby,S.A., Rice,C.M., Ross,M.T., Searle,S.M., Sehra,H.K.,
Sheridan,E., Skuce,C.D., Smith,S., Smith,M., Spraggon,L.,
Squares,S.L., Steward,C.A., Sycamore,N., Tamlyn-Hall,G., Tester,J.,
Theaker,A.J., Thomas,D.W., Thorpe,A., Tracey,A., Tromans,A.,
Tubby,B., Wall,M., Wallis,J.M., West,A.P., White,S.S.,
Whitehead,S.L., Whittaker,H., Wild,A., Willey,D.J., Wilmer,T.E.,
Wood,J.M., Wray,P.W., Wyatt,J.C., Young,L., Younger,R.M.,
Bentley,D.R., Coulson,A., Durbin,R., Hubbard,T., Sulston,J.E.,
Dunham,I., Rogers,J. and Beck,S.
TITLE The DNA sequence and analysis of human chromosome 6
JOURNAL Nature 425 (6960), 805-811 (2003)
PUBMED 14574404
REFERENCE 3 (bases 1 to 1820)
AUTHORS Cavaletto,M., Giuffrida,M.G., Fortunato,D., Gardano,L.,
Dellavalle,G., Napolitano,L., Giunta,C., Bertino,E., Fabris,C. and
Conti,A.
TITLE A proteomic approach to evaluate the butyrophilin gene family
expression in human milk fat globule membrane
JOURNAL Proteomics 2 (7), 850-856 (2002)
PUBMED 12124930
REFERENCE 4 (bases 1 to 1820)
AUTHORS Rhodes,D.A., Stammers,M., Malcherek,G., Beck,S. and Trowsdale,J.
TITLE The cluster of BTN genes in the extended major histocompatibility
complex
JOURNAL Genomics 71 (3), 351-362 (2001)
PUBMED 11170752
REFERENCE 5 (bases 1 to 1820)
AUTHORS Henry,J., Miller,M.M. and Pontarotti,P.
TITLE Structure and evolution of the extended B7 family
JOURNAL Immunol. Today 20 (6), 285-288 (1999)
PUBMED 10354554
REMARK Review article
REFERENCE 6 (bases 1 to 1820)
AUTHORS Ruddy,D.A., Kronmal,G.S., Lee,V.K., Mintier,G.A., Quintana,L.,
Domingo,R. Jr., Meyer,N.C., Irrinki,A., McClelland,E.E., Fullan,A.,
Mapa,F.A., Moore,T., Thomas,W., Loeb,D.B., Harmon,C.,
Tsuchihashi,Z., Wolff,R.K., Schatzman,R.C. and Feder,J.N.
TITLE A 1.1-Mb transcript map of the hereditary hemochromatosis locus
JOURNAL Genome Res. 7 (5), 441-456 (1997)
PUBMED 9149941
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BP234194.1, BC017497.1 and
BC013258.2.
Summary: Butyrophilin is the major protein associated with fat
droplets in the milk. This gene is a member of the BTN2 subfamily
of genes, which encode proteins belonging to the butyrophilin
protein family. The gene is located in a cluster on chromosome 6,
consisting of seven genes belonging to the expanding
B7/butyrophilin-like group, a subset of the immunoglobulin gene
superfamily. The encoded protein is a type I receptor glycoprotein
involved in lipid, fatty-acid and sterol metabolism. Several
alternatively spliced transcript variants encoding different
isoforms have been found for this gene. [provided by RefSeq, Oct
2010].
Transcript Variant: This variant (4) lacks an alternate segment in
the 3' region compared to variant 1, resulting in a shorter isoform
(c) with distinct C-terminus, compared to isoform a.
##Evidence-Data-START##
Transcript exon combination :: BC017497.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025084, ERS025088 [ECO:0000350]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-108 BP234194.1 1-108
109-1355 BC017497.1 1-1247
1356-1356 BC013258.2 2728-2728
1357-1820 BC017497.1 1249-1712
FEATURES Location/Qualifiers
source 1..1820
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="6"
/map="6p22.1"
gene 1..1820
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/note="butyrophilin, subfamily 2, member A2"
/db_xref="GeneID:10385"
/db_xref="HGNC:1137"
/db_xref="MIM:613591"
exon 1..204
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/inference="alignment:Splign:1.39.8"
variation 63
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:9461249"
variation 136
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:9467741"
misc_feature 151..153
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/note="upstream in-frame stop codon"
variation 200
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="c"
/db_xref="dbSNP:375893732"
variation 201..202
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace=""
/replace="ag"
/db_xref="dbSNP:3832422"
exon 205..328
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/inference="alignment:Splign:1.39.8"
CDS 235..1245
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/note="isoform c precursor is encoded by transcript
variant 4; butyrophilin 2"
/codon_start=1
/product="butyrophilin subfamily 2 member A2 isoform c
precursor"
/protein_id="NP_001184167.1"
/db_xref="GI:308522748"
/db_xref="CCDS:CCDS56401.1"
/db_xref="GeneID:10385"
/db_xref="HGNC:1137"
/db_xref="MIM:613591"
/translation="
MEPAAALHFSLPASLLLLLLLLLLSLCALVSAQFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETVIFIPESFMPSASPWMVALAVILTASPWMVSMTVILAVFIIFMAVSICCIKKLQREKKILSGEKKVEQEEKEIAQQLQEELRWRRTFLHADVNLTGLRNT
"
sig_peptide 235..330
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
mat_peptide 331..1242
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/product="butyrophilin subfamily 2 member A2 isoform c"
misc_feature 331..672
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/note="Immunoglobulin V-set domain; Region: V-set;
pfam07686"
/db_xref="CDD:203725"
misc_feature 376..675
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/note="Immunoglobulin (Ig)-like domain of myelin
oligodendrocyte glycoprotein (MOG); Region: Ig_MOG_like;
cd05713"
/db_xref="CDD:143190"
misc_feature order(424..429,484..486,517..519,628..630,634..651)
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/note="antigen binding site; other site"
/db_xref="CDD:143190"
misc_feature 688..936
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/note="Immunoglobulin domain; Region: Ig; cl11960"
/db_xref="CDD:213125"
misc_feature 1030..1092
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q8WVV5.2);
transmembrane region"
variation 240
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:375369181"
variation 242
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:202213069"
variation 245
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:73736234"
variation 273
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="c"
/db_xref="dbSNP:147636357"
variation 291
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:115247877"
exon 329..676
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/inference="alignment:Splign:1.39.8"
variation 342
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:138070617"
variation 343
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:143653188"
variation 349
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="g"
/db_xref="dbSNP:57038103"
variation 394
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:370867259"
variation 411
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:150302333"
variation 412
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:181037825"
variation 439
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:375285642"
variation 440
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:368009368"
variation 475
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="g"
/replace="t"
/db_xref="dbSNP:372237219"
variation 477
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:376950043"
variation 497
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:376558792"
variation 522
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:112257227"
variation 523
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:367692328"
variation 524
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:144702884"
variation 560
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:149453161"
variation 561
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:377645117"
variation 588
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:143017993"
variation 646
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:146154371"
variation 662
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:201687793"
exon 677..958
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/inference="alignment:Splign:1.39.8"
variation 736
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="g"
/db_xref="dbSNP:369291221"
variation 750
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:142411775"
variation 789
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="g"
/db_xref="dbSNP:76088803"
variation 792
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="c"
/db_xref="dbSNP:200834687"
variation 808
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:144410497"
variation 816
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:372854548"
variation 826
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:200036284"
variation 829
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:201605260"
variation 833
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:139541725"
variation 841
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:62617839"
variation 861
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:370196656"
variation 899
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:145439434"
variation 918
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:201008184"
variation 922
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:200096466"
variation 925
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:373346354"
variation 956
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:201995913"
exon 959..1165
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/inference="alignment:Splign:1.39.8"
variation 962
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="c"
/db_xref="dbSNP:375385023"
variation 1021
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:369920399"
variation 1033
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="g"
/replace="t"
/db_xref="dbSNP:113893469"
variation 1034
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:373492069"
variation 1042
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="g"
/db_xref="dbSNP:147003451"
variation 1165
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="g"
/db_xref="dbSNP:201972159"
exon 1166..1186
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/inference="alignment:Splign:1.39.8"
exon 1187..1213
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/inference="alignment:Splign:1.39.8"
exon 1214..1790
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/inference="alignment:Splign:1.39.8"
variation 1220
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="t"
/db_xref="dbSNP:113353347"
variation 1261
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:72500812"
variation 1415
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:59001682"
variation 1449
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="c"
/replace="t"
/db_xref="dbSNP:73387026"
variation 1722
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
/replace="a"
/replace="g"
/db_xref="dbSNP:189684950"
polyA_signal 1770..1775
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
polyA_site 1790
/gene="BTN2A2"
/gene_synonym="BT2.2; BTF2"
ORIGIN
agtggaaatcttgggactttttggacacccagagaacaggtcccagataccgagtccgcaactccaaacatcgcgattaataggaggtgaacacagcttttctcttctctttgggatgctttgttgtctggtggtgactgtgcccatgggtgagttgtatcggaaaatcgtcatgtgaggatcagaggggaaaagaaaacagaggcctctggtctctgcctgccctgggtgctcatggaaccagctgctgctctgcacttctccctgccagcctccctcctcctcctcctgctcctcctccttctcagcctgtgtgcactggtctcagcccagtttactgtcgtggggccagctaatcccatcctggccatggtgggagaaaacactacattacgctgccatctgtcacccgagaaaaatgctgaggacatggaggtgcggtggttccggtctcagttctcccccgcagtgtttgtgtataagggtgggagagagagaacagaggagcagatggaggagtaccggggaagaatcacctttgtgagcaaagacatcaacaggggcagcgtggccctggtcatacataacgtcacagcccaggagaatgggatctaccgctgttacttccaagaaggcaggtcctacgatgaggccatcctacgcctcgtggtggcaggccttgggtctaagcccctcattgaaatcaaggcccaagaggatgggagcatctggctggagtgcatatctggagggtggtacccagagcccctcacagtgtggagggacccctacggtgaggttgtgcccgccctgaaggaggtttccatcgctgatgctgacggcctcttcatggtcaccacagctgtgatcatcagagacaagtatgtgaggaatgtgtcctgctctgtcaacaacaccctgctcggccaggagaaggaaactgtcatttttattccagaatcctttatgcccagcgcatctccctggatggtggccctagctgtcatcctgaccgcatctccctggatggtgtccatgactgtcatcctggctgttttcatcatcttcatggctgtcagcatctgttgcatcaagaaacttcaaagggaaaaaaagattctgtcaggggaaaagaaagttgaacaagaggaaaaagaaattgcacagcaacttcaagaagaattgcgatggagaagaacattcttacatgctgatgtcaacctgactggattaaggaatacctagacagctggtacaacattatttctgggtgtgtctgtgagtgtgtttccagaagagattggcaagtgagtcagtgggaaattctctccttctgttggctgggtgcccaatacaacaaaaaggcagaggaaaggcaaattcttctctcctctggagctgagacactcttcttcttctgcccttggacatcagaactcctggctctccggcctttgaacttcaggacttgtaccaggaggccctgggttctcaggcctttggctttggactgagagttacacaatcagcttccctggttctgaggctttcagacttaaactgagccatgctaccagcatcccagggtctccagcctacagatgagctgttgtgcgatttcttagcctccataatcacatgagccaatctccttaataaatgcctgctcatagatctgtatctacatctatatctgtatgtgcatctatatctatgcctatatctatatctatatcatattgattttgtctctctggagaaccctgactaataaaatgaggcatctaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:10385 -> Biological process: GO:0031324 [negative regulation of cellular metabolic process] evidence: ISS
GeneID:10385 -> Biological process: GO:0046007 [negative regulation of activated T cell proliferation] evidence: ISS
GeneID:10385 -> Biological process: GO:0050710 [negative regulation of cytokine secretion] evidence: ISS
GeneID:10385 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.