2025-09-16 22:35:14, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_145652 1018 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens WAP four-disulfide core domain 5 (WFDC5), mRNA. ACCESSION NM_145652 VERSION NM_145652.3 GI:336391118 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1018) AUTHORS Mukhopadhyay,S.S. and Rosen,J.M. TITLE The C-terminal domain of the nuclear factor I-B2 isoform is glycosylated and transactivates the WAP gene in the JEG-3 cells JOURNAL Biochem. Biophys. Res. Commun. 358 (3), 770-776 (2007) PUBMED 17511965 REMARK GeneRIF: C-terminal domain of the nuclear factor I-B2 isoform is glycosylated and transactivates the WAP gene in tumor cells REFERENCE 2 (bases 1 to 1018) AUTHORS Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z., Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S., McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J., Dunham,I., Hill,D.E. and Vidal,M. TITLE hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes JOURNAL Genomics 89 (3), 307-315 (2007) PUBMED 17207965 REFERENCE 3 (bases 1 to 1018) AUTHORS Nukumi,N., Seki,M., Iwamori,T., Yada,T., Naito,K. and Tojo,H. TITLE Analysis of the promoter of mutated human whey acidic protein (WAP) gene JOURNAL J. Reprod. Dev. 52 (2), 315-320 (2006) PUBMED 16462094 REMARK GeneRIF: analysis of promoter of mutated human whey acidic protein (WAP) gene REFERENCE 4 (bases 1 to 1018) AUTHORS Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J., Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B., Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E., Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S., Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C., Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V., Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K., Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z., Goddard,A., Wood,W.I., Godowski,P. and Gray,A. TITLE The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment JOURNAL Genome Res. 13 (10), 2265-2270 (2003) PUBMED 12975309 REMARK Erratum:[Genome Res. 2003 Dec;13(12):2759] REFERENCE 5 (bases 1 to 1018) AUTHORS Clauss,A., Lilja,H. and Lundwall,A. TITLE A locus on human chromosome 20 contains several genes expressing protease inhibitor domains with homology to whey acidic protein JOURNAL Biochem. J. 368 (PT 1), 233-242 (2002) PUBMED 12206714 REFERENCE 6 (bases 1 to 1018) AUTHORS Deloukas,P., Matthews,L.H., Ashurst,J., Burton,J., Gilbert,J.G., Jones,M., Stavrides,G., Almeida,J.P., Babbage,A.K., Bagguley,C.L., Bailey,J., Barlow,K.F., Bates,K.N., Beard,L.M., Beare,D.M., Beasley,O.P., Bird,C.P., Blakey,S.E., Bridgeman,A.M., Brown,A.J., Buck,D., Burrill,W., Butler,A.P., Carder,C., Carter,N.P., Chapman,J.C., Clamp,M., Clark,G., Clark,L.N., Clark,S.Y., Clee,C.M., Clegg,S., Cobley,V.E., Collier,R.E., Connor,R., Corby,N.R., Coulson,A., Coville,G.J., Deadman,R., Dhami,P., Dunn,M., Ellington,A.G., Frankland,J.A., Fraser,A., French,L., Garner,P., Grafham,D.V., Griffiths,C., Griffiths,M.N., Gwilliam,R., Hall,R.E., Hammond,S., Harley,J.L., Heath,P.D., Ho,S., Holden,J.L., Howden,P.J., Huckle,E., Hunt,A.R., Hunt,S.E., Jekosch,K., Johnson,C.M., Johnson,D., Kay,M.P., Kimberley,A.M., King,A., Knights,A., Laird,G.K., Lawlor,S., Lehvaslaiho,M.H., Leversha,M., Lloyd,C., Lloyd,D.M., Lovell,J.D., Marsh,V.L., Martin,S.L., McConnachie,L.J., McLay,K., McMurray,A.A., Milne,S., Mistry,D., Moore,M.J., Mullikin,J.C., Nickerson,T., Oliver,K., Parker,A., Patel,R., Pearce,T.A., Peck,A.I., Phillimore,B.J., Prathalingam,S.R., Plumb,R.W., Ramsay,H., Rice,C.M., Ross,M.T., Scott,C.E., Sehra,H.K., Shownkeen,R., Sims,S., Skuce,C.D., Smith,M.L., Soderlund,C., Steward,C.A., Sulston,J.E., Swann,M., Sycamore,N., Taylor,R., Tee,L., Thomas,D.W., Thorpe,A., Tracey,A., Tromans,A.C., Vaudin,M., Wall,M., Wallis,J.M., Whitehead,S.L., Whittaker,P., Willey,D.L., Williams,L., Williams,S.A., Wilming,L., Wray,P.W., Hubbard,T., Durbin,R.M., Bentley,D.R., Beck,S. and Rogers,J. TITLE The DNA sequence and comparative analysis of human chromosome 20 JOURNAL Nature 414 (6866), 865-871 (2001) PUBMED 11780052 REFERENCE 7 (bases 1 to 1018) AUTHORS Horikoshi,N., Cong,J., Kley,N. and Shenk,T. TITLE Isolation of differentially expressed cDNAs from p53-dependent apoptotic cells: activation of the human homologue of the Drosophila peroxidasin gene JOURNAL Biochem. Biophys. Res. Commun. 261 (3), 864-869 (1999) PUBMED 10441517 REFERENCE 8 (bases 1 to 1018) AUTHORS Ranganathan,S., Simpson,K.J., Shaw,D.C. and Nicholas,K.R. TITLE The whey acidic protein family: a new signature motif and three-dimensional structure by comparative modeling JOURNAL J. Mol. Graph. Model. 17 (2), 106-113 (1999) PUBMED 10680116 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AY358822.1, BC039173.1 and Z93016.2. On Jun 18, 2011 this sequence version replaced gi:23238241. Summary: This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. [provided by RefSeq, Jul 2008]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: AY358822.1, BC039173.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025085 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-34 AY358822.1 1-34 35-1002 BC039173.1 1-968 1003-1018 Z93016.2 110236-110251 c FEATURES Location/Qualifiers source 1..1018 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="20" /map="20q13.12" gene 1..1018 /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /note="WAP four-disulfide core domain 5" /db_xref="GeneID:149708" /db_xref="HGNC:20477" /db_xref="MIM:605161" exon 1..174 /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /inference="alignment:Splign:1.39.8" variation complement(11..14) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="" /replace="ctga" /db_xref="dbSNP:375288891" variation complement(13..16) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="" /replace="gact" /db_xref="dbSNP:147846563" variation complement(45) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:73910118" misc_feature 72..74 /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /note="upstream in-frame stop codon" variation complement(77) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="c" /replace="t" /db_xref="dbSNP:371339713" variation complement(78) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:200540832" CDS 90..461 /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /note="protease inhibitor WAP1; WAP four-disulfide core domain protein 5; p53-responsive gene 5 protein; putative protease inhibitor WAP1" /codon_start=1 /product="WAP four-disulfide core domain protein 5 precursor" /protein_id="NP_663627.1" /db_xref="GI:21717822" /db_xref="CCDS:CCDS33475.1" /db_xref="GeneID:149708" /db_xref="HGNC:20477" /db_xref="MIM:605161" /translation="
MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCVEDSQCPLTRKCCYRACFRQCVPRVSVKLGSCPEDQLRCLSPMNHLCHKDSDCSGKKRCCHSACGRDCRDPARG
" sig_peptide 90..161 /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /inference="COORDINATES: ab initio prediction:SignalP:4.0" mat_peptide 162..458 /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /product="WAP four-disulfide core domain protein 5" misc_feature 273..452 /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /note="whey acidic protein-type four-disulfide core domains. Members of the family include whey acidic protein, elafin (elastase-specific inhibitor), caltrin-like protein (a calcium transport inhibitor) and other extracellular proteinase inhibitors. A group of...; Region: WAP; cd00199" /db_xref="CDD:29256" misc_feature 321..341 /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /note="inhibitory loop; inhibition site" /db_xref="CDD:29256" variation complement(92) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:140685506" exon 175..315 /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /inference="alignment:Splign:1.39.8" variation complement(182) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:138962368" variation complement(197) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:111660564" variation complement(220) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="c" /replace="t" /db_xref="dbSNP:141103884" variation complement(221) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:114264609" variation complement(237) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:374696524" variation complement(291) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="c" /replace="t" /db_xref="dbSNP:142074298" variation complement(292) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:370436377" exon 316..456 /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /inference="alignment:Splign:1.39.8" variation complement(342) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="c" /db_xref="dbSNP:116574899" variation complement(349) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:114645401" variation complement(354) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="c" /replace="t" /db_xref="dbSNP:199500433" variation complement(378) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="c" /replace="t" /db_xref="dbSNP:17422688" variation complement(397) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="c" /replace="t" /db_xref="dbSNP:79417830" variation complement(422) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="c" /replace="t" /db_xref="dbSNP:373684757" variation complement(428) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="c" /replace="t" /db_xref="dbSNP:145123781" variation complement(429) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:374180478" variation complement(433) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:139507452" variation complement(442) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:111992595" exon 457..1018 /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /inference="alignment:Splign:1.39.8" variation complement(541) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="c" /db_xref="dbSNP:199710758" variation complement(543) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="c" /replace="t" /db_xref="dbSNP:370593294" variation complement(546) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="c" /replace="t" /db_xref="dbSNP:373859109" variation complement(568) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="c" /replace="t" /db_xref="dbSNP:188147053" variation complement(679) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:79707292" variation complement(682) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="c" /replace="t" /db_xref="dbSNP:150516709" variation complement(719) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:184894433" variation complement(740) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:368455958" variation complement(793) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:6094096" variation complement(801) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="c" /replace="t" /db_xref="dbSNP:6031997" variation complement(816) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:6094095" variation complement(846) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="c" /replace="t" /db_xref="dbSNP:180895744" variation complement(870) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:190510993" variation complement(920) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:6094094" variation complement(927) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="c" /replace="t" /db_xref="dbSNP:114781738" variation complement(928) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:112924458" variation complement(943) /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" /replace="a" /replace="g" /db_xref="dbSNP:6130753" polyA_signal 985..990 /gene="WFDC5" /gene_synonym="dJ211D12.5; PRG5; WAP1" ORIGIN
ctttcctctcctgactaagtttctctggcttccctgaggctgcaggtgttaatctggggggccctgggccctgagccggcagcagaaatatgaggacccagagccttctcctcctgggggccctcctggctgtggggagtcagctgcctgctgtctttggcaggaagaagggagagaaatcggggggctgcccgccagatgatgggccctgcctcctatcggtgcctgaccagtgcgtggaagacagccagtgtcccttgaccaggaagtgctgctacagagcttgcttccgccagtgtgtccccagggtctctgtgaagctgggcagctgcccagaggaccaactgcgctgcctcagccccatgaaccacctgtgtcacaaggactcagactgctcgggcaaaaagcgatgctgccacagcgcctgcgggcgggattgccgggatcctgccagaggctaattctgatttaggatctgtggctctgcacctaagctggggaccaacggaaagagttcacgatgggaggcctggggccctgcccgctggacagcactatctctaccagcggtggttccagccttctgataatcactggcctgctgacacttccctgcaacccatccacccctggtttctcctcctgggagtcaaagtccatagcctgagctcggaggaaggcctctgtatcaccccagtactctgcaccactgccatacgagcttcccacccttcctaacgctttcacaccaatccgtacatgctgcttcctccaccaaaaatgcccaattcaggcagaccctgacctctccctcaggcagcccaaccatccagaatgaatattcttgcagagttttccaaacatcagtcattcacctctttcatgattttcaccatacctacaaaatagcaccatgataggttgcacgctgcctgtaccaccatttacttaatgttttctttaaatggctcacttttgtatataaataaattcatttcaaaagaaaattgatatcact
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:149708 -> Molecular function: GO:0004867 [serine-type endopeptidase inhibitor activity] evidence: IEA GeneID:149708 -> Cellular component: GO:0005576 [extracellular region] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.