GGRNA | NM_006519.2

LOCUS       NM_006519                774 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens dynein, light chain, Tctex-type 1 (DYNLT1), mRNA.
ACCESSION   NM_006519
VERSION     NM_006519.2  GI:295842198
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 774)
  AUTHORS   Palmer,K.J., MacCarthy-Morrogh,L., Smyllie,N. and Stephens,D.J.
  TITLE     A role for Tctex-1 (DYNLT1) in controlling primary cilium length
  JOURNAL   Eur. J. Cell Biol. 90 (10), 865-871 (2011)
   PUBMED   21700358
  REMARK    GeneRIF: A role for Tctex-1 (DYNLT1) in controlling primary cilium
            length
REFERENCE   2  (bases 1 to 774)
  AUTHORS   Brault,J.B., Kudelko,M., Vidalain,P.O., Tangy,F., Despres,P. and
            Pardigon,N.
  TITLE     The interaction of flavivirus M protein with light chain Tctex-1 of
            human dynein plays a role in late stages of virus replication
  JOURNAL   Virology 417 (2), 369-378 (2011)
   PUBMED   21767858
  REMARK    GeneRIF: These data show that Tctex-1 may play a role in late
            stages of viral replication through its interaction with the
            flavivirus membrane protein.
REFERENCE   3  (bases 1 to 774)
  AUTHORS   Ochiai,K., Watanabe,M., Ueki,H., Huang,P., Fujii,Y., Nasu,Y.,
            Noguchi,H., Hirata,T., Sakaguchi,M., Huh,N.H., Kashiwakura,Y.,
            Kaku,H. and Kumon,H.
  TITLE     Tumor suppressor REIC/Dkk-3 interacts with the dynein light chain,
            Tctex-1
  JOURNAL   Biochem. Biophys. Res. Commun. 412 (2), 391-395 (2011)
   PUBMED   21835165
  REMARK    GeneRIF: A link between REIC/Dkk- 3 and Tctex-1 may therefore be of
            significance for understanding the molecular functions of the
            proteins in ER stress signaling and the intracellular dynein motor
            dynamics, respectively.
REFERENCE   4  (bases 1 to 774)
  AUTHORS   Fang,Y.D., Xu,X., Dang,Y.M., Zhang,Y.M., Zhang,J.P., Hu,J.Y.,
            Zhang,Q., Dai,X., Teng,M., Zhang,D.X. and Huang,Y.S.
  TITLE     MAP4 mechanism that stabilizes mitochondrial permeability
            transition in hypoxia: microtubule enhancement and DYNLT1
            interaction with VDAC1
  JOURNAL   PLoS ONE 6 (12), E28052 (2011)
   PUBMED   22164227
  REMARK    GeneRIF: there are two possible mechanisms triggered by MAP4:
            stabilization of MT networks; DYNLT1 modulation, which is connected
            with VDAC1, and inhibition of hypoxia-induced mitochondrial
            permeabilization
REFERENCE   5  (bases 1 to 774)
  AUTHORS   Duguay,D., Belanger-Nelson,E., Mongrain,V., Beben,A.,
            Khatchadourian,A. and Cermakian,N.
  TITLE     Dynein light chain Tctex-type 1 modulates orexin signaling through
            its interaction with orexin 1 receptor
  JOURNAL   PLoS ONE 6 (10), E26430 (2011)
   PUBMED   22028875
  REMARK    GeneRIF: Dynlt1 modulates orexin signaling by regulating OX1R
REFERENCE   6  (bases 1 to 774)
  AUTHORS   Mueller,S., Cao,X., Welker,R. and Wimmer,E.
  TITLE     Interaction of the poliovirus receptor CD155 with the dynein light
            chain Tctex-1 and its implication for poliovirus pathogenesis
  JOURNAL   J. Biol. Chem. 277 (10), 7897-7904 (2002)
   PUBMED   11751937
  REMARK    GeneRIF: Association with Tctex-1 and, hence, with the dynein motor
            complex may offer an explanation for how poliovirus hijacks the
            cellular transport machinery to retrogradely ascend along the axon
            to the neuronal cell body.
REFERENCE   7  (bases 1 to 774)
  AUTHORS   Strovel,E.T., Wu,D. and Sussman,D.J.
  TITLE     Protein phosphatase 2Calpha dephosphorylates axin and activates
            LEF-1-dependent transcription
  JOURNAL   J. Biol. Chem. 275 (4), 2399-2403 (2000)
   PUBMED   10644691
REFERENCE   8  (bases 1 to 774)
  AUTHORS   Nagano,F., Orita,S., Sasaki,T., Naito,A., Sakaguchi,G., Maeda,M.,
            Watanabe,T., Kominami,E., Uchiyama,Y. and Takai,Y.
  TITLE     Interaction of Doc2 with tctex-1, a light chain of cytoplasmic
            dynein. Implication in dynein-dependent vesicle transport
  JOURNAL   J. Biol. Chem. 273 (46), 30065-30068 (1998)
   PUBMED   9804756
REFERENCE   9  (bases 1 to 774)
  AUTHORS   King,S.M., Dillman,J.F. III, Benashski,S.E., Lye,R.J.,
            Patel-King,R.S. and Pfister,K.K.
  TITLE     The mouse t-complex-encoded protein Tctex-1 is a light chain of
            brain cytoplasmic dynein
  JOURNAL   J. Biol. Chem. 271 (50), 32281-32287 (1996)
   PUBMED   8943288
REFERENCE   10 (bases 1 to 774)
  AUTHORS   Watanabe,T.K., Fujiwara,T., Shimizu,F., Okuno,S., Suzuki,M.,
            Takahashi,E., Nakamura,Y. and Hirai,Y.
  TITLE     Cloning, expression, and mapping of TCTEL1, a putative human
            homologue of murine Tcte1, to 6q
  JOURNAL   Cytogenet. Cell Genet. 73 (1-2), 153-156 (1996)
   PUBMED   8646886
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL589931.14, D50663.1 and BU675683.1.
            On May 7, 2010 this sequence version replaced gi:5730084.
            
            Summary: Cytoplasmic dynein is the major motor protein complex
            responsible for minus-end, microtubule-based motile processes. Each
            dynein complex consists of 2 heavy chains that have ATPase and
            motor activities, plus a group of accessory polypeptides. TCTEX1 is
            a dynein light chain involved in cargo binding (Chuang et al., 2005
            [PubMed 15992542]).[supplied by OMIM, Mar 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BG035722.1, BG703409.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-52                AL589931.14        7964-8015           c
            53-756              D50663.1           1-704
            757-774             BU675683.1         1-18                c
FEATURES             Location/Qualifiers
     source          1..774
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="6"
                     /map="6q25.2-q25.3"
     gene            1..774
                     /gene="DYNLT1"
                     /gene_synonym="CW-1; TCTEL1; tctex-1"
                     /note="dynein, light chain, Tctex-type 1"
                     /db_xref="GeneID:6993"
                     /db_xref="HGNC:11697"
                     /db_xref="HPRD:15987"
                     /db_xref="MIM:601554"
     exon            1..91
                     /gene="DYNLT1"
                     /gene_synonym="CW-1; TCTEL1; tctex-1"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    5..7
                     /gene="DYNLT1"
                     /gene_synonym="CW-1; TCTEL1; tctex-1"
                     /note="upstream in-frame stop codon"
     CDS             65..406
                     /gene="DYNLT1"
                     /gene_synonym="CW-1; TCTEL1; tctex-1"
                     /note="t-complex-associated-testis-expressed 1-like 1;
                     T-complex testis-specific protein 1 homolog"
                     /codon_start=1
                     /product="dynein light chain Tctex-type 1"
                     /protein_id="NP_006510.1"
                     /db_xref="GI:5730085"
                     /db_xref="CCDS:CCDS5257.1"
                     /db_xref="GeneID:6993"
                     /db_xref="HGNC:11697"
                     /db_xref="HPRD:15987"
                     /db_xref="MIM:601554"
                     /translation="

MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI

"
     misc_feature    104..403
                     /gene="DYNLT1"
                     /gene_synonym="CW-1; TCTEL1; tctex-1"
                     /note="Tctex-1 family; Region: Tctex-1; pfam03645"
                     /db_xref="CDD:202715"
     misc_feature    185..403
                     /gene="DYNLT1"
                     /gene_synonym="CW-1; TCTEL1; tctex-1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P63172.1);
                     Region: Interaction with GNB1 (By similarity)"
     exon            92..133
                     /gene="DYNLT1"
                     /gene_synonym="CW-1; TCTEL1; tctex-1"
                     /inference="alignment:Splign:1.39.8"
     exon            134..257
                     /gene="DYNLT1"
                     /gene_synonym="CW-1; TCTEL1; tctex-1"
                     /inference="alignment:Splign:1.39.8"
     exon            258..335
                     /gene="DYNLT1"
                     /gene_synonym="CW-1; TCTEL1; tctex-1"
                     /inference="alignment:Splign:1.39.8"
     exon            336..759
                     /gene="DYNLT1"
                     /gene_synonym="CW-1; TCTEL1; tctex-1"
                     /inference="alignment:Splign:1.39.8"
     STS             476..634
                     /gene="DYNLT1"
                     /gene_synonym="CW-1; TCTEL1; tctex-1"
                     /standard_name="A005A07"
                     /db_xref="UniSTS:5624"
     STS             476..634
                     /gene="DYNLT1"
                     /gene_synonym="CW-1; TCTEL1; tctex-1"
                     /standard_name="G32210"
                     /db_xref="UniSTS:116817"
     variation       528
                     /gene="DYNLT1"
                     /gene_synonym="CW-1; TCTEL1; tctex-1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1804639"
     variation       645
                     /gene="DYNLT1"
                     /gene_synonym="CW-1; TCTEL1; tctex-1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1804638"
ORIGIN

ggcctgagtgcgcctgcgcagtccgcgccactcagggagccggaggggacgcgccggaggaaagatggaagactaccaggctgcggaggagactgcttttgttgttgatgaagtgagcaacattgtaaaagaggctatagaaagcgcaattggtggtaacgcttatcaacacagcaaagtgaaccagtggaccacaaatgtagtagaacaaactttaagccaactcaccaagctgggaaaaccatttaaatacatcgtgacctgtgtaattatgcagaagaatggagctggattacacacagcaagttcctgcttctgggacagctctactgacgggagctgcactgtgcgatgggagaataagaccatgtactgcatcgtcagtgccttcggactgtctatttgacctgcagtccagcctatggcctttctccttttgtctctagttcatcctctaaccaccagccatgaattcagtgaactcttttctcattctctttgttttgtggcactttcacaatgtagaggaaaaaaccaaatgaccgcactgtgatgtgaatggcaccgaagtcagatgagtatccctgtaggtcacctgcagcctgcgttgccacttgtcttaactctgaatatttcatttcaaaggtgctaaaatctgaaatctgctagtgtgaaacttgctctactctctgaaatgattcaaatacactaattttccatactttatacttttgttagaataaattattcaaatctaaaaaaaaaaaaaaaaaa

//

Annotations: