GGRNA Home | Help | Advanced search

2026-04-28 17:12:49, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001159353            1176 bp    mRNA    linear   PRI 12-MAY-2013
DEFINITION  Homo sapiens regenerating islet-derived family, member 4 (REG4),
            transcript variant 3, mRNA.
ACCESSION   NM_001159353
VERSION     NM_001159353.1  GI:226823234
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1176)
  AUTHORS   Ying,L.S., Yu,J.L., Lu,X.X. and Ling,Z.Q.
  TITLE     Enhanced RegIV expression predicts the intrinsic 5-fluorouracil
            (5-FU) resistance in advanced gastric cancer
  JOURNAL   Dig. Dis. Sci. 58 (2), 414-422 (2013)
   PUBMED   23010741
  REMARK    GeneRIF: RegIV may play an important role in the intrinsic
            resistance of gastric cancer cells to 5-FU.
REFERENCE   2  (bases 1 to 1176)
  AUTHORS   He,X.J., Jiang,X.T., Ma,Y.Y., Xia,Y.J., Wang,H.J., Guan,T.P.,
            Shao,Q.S. and Tao,H.Q.
  TITLE     REG4 contributes to the invasiveness of pancreatic cancer by
            upregulating MMP-7 and MMP-9
  JOURNAL   Cancer Sci. 103 (12), 2082-2091 (2012)
   PUBMED   22957785
  REMARK    GeneRIF: REG4 promotes not only growth but also in vitro
            invasiveness of pancreatic cancer cells by upregulating MMP-7 and
            MMP-9.
REFERENCE   3  (bases 1 to 1176)
  AUTHORS   Katsuno,Y., Ehata,S., Yashiro,M., Yanagihara,K., Hirakawa,K. and
            Miyazono,K.
  TITLE     Coordinated expression of REG4 and aldehyde dehydrogenase 1
            regulating tumourigenic capacity of diffuse-type gastric
            carcinoma-initiating cells is inhibited by TGF-beta
  JOURNAL   J. Pathol. 228 (3), 391-404 (2012)
   PUBMED   22430847
  REMARK    GeneRIF: TGF-beta signalling reduces the expression of ALDH1 and
            REG4, and the size of the ALDH1+ cell population.
REFERENCE   4  (bases 1 to 1176)
  AUTHORS   Naito,Y., Oue,N., Hinoi,T., Sakamoto,N., Sentani,K., Ohdan,H.,
            Yanagihara,K., Sasaki,H. and Yasui,W.
  TITLE     Reg IV is a direct target of intestinal transcriptional factor CDX2
            in gastric cancer
  JOURNAL   PLoS ONE 7 (11), E47545 (2012)
   PUBMED   23133598
  REMARK    GeneRIF: CDX2 protein directly regulates Reg IV expression in
            gastric cancer
REFERENCE   5  (bases 1 to 1176)
  AUTHORS   Wang,Q., Deng,J., Yuan,J., Wang,L., Zhao,Z., He,S., Zhang,Y. and
            Tu,Y.
  TITLE     Oncogenic reg IV is a novel prognostic marker for glioma patient
            survival
  JOURNAL   Diagn Pathol 7, 69 (2012)
   PUBMED   22713481
  REMARK    GeneRIF: Suggest that Reg IV might accelerate disease progression
            and act as a candidate prognostic marker for gliomas.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1176)
  AUTHORS   Zhang,Z. and Henzel,W.J.
  TITLE     Signal peptide prediction based on analysis of experimentally
            verified cleavage sites
  JOURNAL   Protein Sci. 13 (10), 2819-2824 (2004)
   PUBMED   15340161
REFERENCE   7  (bases 1 to 1176)
  AUTHORS   Zhang,Y., Lai,M., Lv,B., Gu,X., Wang,H., Zhu,Y., Zhu,Y., Shao,L.
            and Wang,G.
  TITLE     Overexpression of Reg IV in colorectal adenoma
  JOURNAL   Cancer Lett. 200 (1), 69-76 (2003)
   PUBMED   14550954
  REMARK    GeneRIF: overexpression of Reg IV may be an early event in
            colorectal carcinogenesis.
REFERENCE   8  (bases 1 to 1176)
  AUTHORS   Kamarainen,M., Heiskala,K., Knuutila,S., Heiskala,M., Winqvist,O.
            and Andersson,L.C.
  TITLE     RELP, a novel human REG-like protein with up-regulated expression
            in inflammatory and metaplastic gastrointestinal mucosa
  JOURNAL   Am. J. Pathol. 163 (1), 11-20 (2003)
   PUBMED   12819006
  REMARK    GeneRIF: Results suggest that RELP might be involved in
            inflammatory and metaplastic responses of the gastrointestinal
            epithelium.
REFERENCE   9  (bases 1 to 1176)
  AUTHORS   Violette,S., Festor,E., Pandrea-Vasile,I., Mitchell,V., Adida,C.,
            Dussaulx,E., Lacorte,J.M., Chambaz,J., Lacasa,M. and Lesuffleur,T.
  TITLE     Reg IV, a new member of the regenerating gene family, is
            overexpressed in colorectal carcinomas
  JOURNAL   Int. J. Cancer 103 (2), 185-193 (2003)
   PUBMED   12455032
REFERENCE   10 (bases 1 to 1176)
  AUTHORS   Hartupee,J.C., Zhang,H., Bonaldo,M.F., Soares,M.B. and
            Dieckgraefe,B.K.
  TITLE     Isolation and characterization of a cDNA encoding a novel member of
            the human regenerating protein family: Reg IV
  JOURNAL   Biochim. Biophys. Acta 1518 (3), 287-293 (2001)
   PUBMED   11311942
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL359752.11 and AY126672.1.
            
            Transcript Variant: This variant (3) lacks several 3' exons but has
            an alternate 3' end, as compared to variant 1. The resulting
            isoform (2) has a shorter and different C-terminus, as compared to
            isoform 1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY126672.1, DB010408.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025094 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-49                AL359752.11        21061-21109         c
            50-472              AY126672.1         50-472
            473-1176            AL359752.11        11852-12555         c
FEATURES             Location/Qualifiers
     source          1..1176
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1p13.1-p12"
     gene            1..1176
                     /gene="REG4"
                     /gene_synonym="GISP; REG-IV; RELP"
                     /note="regenerating islet-derived family, member 4"
                     /db_xref="GeneID:83998"
                     /db_xref="HGNC:22977"
                     /db_xref="MIM:609846"
     exon            1..172
                     /gene="REG4"
                     /gene_synonym="GISP; REG-IV; RELP"
                     /inference="alignment:Splign:1.39.8"
     variation       142..147
                     /gene="REG4"
                     /gene_synonym="GISP; REG-IV; RELP"
                     /replace=""
                     /replace="aggggc"
                     /db_xref="dbSNP:3216034"
     exon            173..333
                     /gene="REG4"
                     /gene_synonym="GISP; REG-IV; RELP"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    240..242
                     /gene="REG4"
                     /gene_synonym="GISP; REG-IV; RELP"
                     /note="upstream in-frame stop codon"
     CDS             267..671
                     /gene="REG4"
                     /gene_synonym="GISP; REG-IV; RELP"
                     /note="isoform 2 precursor is encoded by transcript
                     variant 3; regenerating gene type IV; gastrointestinal
                     secretory protein; regenerating islet-derived protein 4;
                     REG-4; reg IV; REG-like protein; regenerating
                     islet-derived protein IV"
                     /codon_start=1
                     /product="regenerating islet-derived protein 4 isoform 2
                     precursor"
                     /protein_id="NP_001152825.1"
                     /db_xref="GI:226823235"
                     /db_xref="CCDS:CCDS53354.1"
                     /db_xref="GeneID:83998"
                     /db_xref="HGNC:22977"
                     /db_xref="MIM:609846"
                     /translation="
MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAEVRNLLPAWPGLSRAKDQPEPQISFDSGSSVLPGHYEEKPLWLVKWREEGCVFNSFNSVSIAEAGAVCQTLDGLQAHTDT
"
     sig_peptide     267..332
                     /gene="REG4"
                     /gene_synonym="GISP; REG-IV; RELP"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    354..>431
                     /gene="REG4"
                     /gene_synonym="GISP; REG-IV; RELP"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cl02432"
                     /db_xref="CDD:207592"
     exon            334..1176
                     /gene="REG4"
                     /gene_synonym="GISP; REG-IV; RELP"
                     /inference="alignment:Splign:1.39.8"
     variation       473
                     /gene="REG4"
                     /gene_synonym="GISP; REG-IV; RELP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3009202"
     variation       905
                     /gene="REG4"
                     /gene_synonym="GISP; REG-IV; RELP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1772387"
     variation       1021
                     /gene="REG4"
                     /gene_synonym="GISP; REG-IV; RELP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1660605"
ORIGIN      
ataagacttttatggatggattgtttttctcaaataatattatcgctttgtgactaaagtaaagattattaattcctgaggcaagaagatataaaagctccagaaacgttgactgggaccactggagacactgaagaaggcaggggcccttagagtcttggttgccaaacagatttgcagatcaaggagaacccaggagtttcaaagaagcgctagtaaggtctctgagatccttgcactagctacatcctcagggtaggaggaagatggcttccagaagcatgcggctgctcctattgctgagctgcctggccaaaacaggagtcctgggtgatatcatcatgagacccagctgtgctcctggatggttttaccacaagtccaattgctatggttacttcaggaagctgaggaactggtctgatgccgaggtaagaaacttgctgcctgcttggcctggcctttctagagcaaaggaccagccagagccccagatctcatttgattcaggatcaagtgtccttcctgggcactatgaagagaagcccctttggctggtgaaatggagagaagagggttgtgtgttcaactcattcaattctgtaagcattgctgaagcaggtgctgtatgccagaccctagatgggctacaagcacatacggatacataggaaagagcccctaccctcagcaagctcactgtcagtaaaggagacagaaatacatcaatcaaaggaggaagagaagatgaggaattcacagaaaggataatggagtttctgtacaagatttaccagaaagagagtggtgtgtagacatgcctggagcagacaccttggagccgctgacagaaggtgaagcagtccaagaaaatgtggaaacttttccgctgctctacacagtccacaaacctgtccattttatttcgttgaagctttgtctgagagataaccaaatagacagtcaaagtaagttatctcagccacatatggggagtggatgctgctgaattgtgattaattgggggagccatataggtacatttggcatgatctgggcctatgcggtcttacaatccctgtataaaactagacaatgaaaaacagaaaacaaaacaaacaaacaaaaaaacaagaacgaagcacctaccacatgccagctactgaggctatgaag
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:83998 -> Molecular function: GO:0030246 [carbohydrate binding] evidence: IEA
            GeneID:83998 -> Cellular component: GO:0005576 [extracellular region] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.