Home |
Help |
Advanced search
2025-11-16 14:30:18, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001159352 1517 bp mRNA linear PRI 12-MAY-2013
DEFINITION Homo sapiens regenerating islet-derived family, member 4 (REG4),
transcript variant 1, mRNA.
ACCESSION NM_001159352
VERSION NM_001159352.1 GI:226823232
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1517)
AUTHORS Ying,L.S., Yu,J.L., Lu,X.X. and Ling,Z.Q.
TITLE Enhanced RegIV expression predicts the intrinsic 5-fluorouracil
(5-FU) resistance in advanced gastric cancer
JOURNAL Dig. Dis. Sci. 58 (2), 414-422 (2013)
PUBMED 23010741
REMARK GeneRIF: RegIV may play an important role in the intrinsic
resistance of gastric cancer cells to 5-FU.
REFERENCE 2 (bases 1 to 1517)
AUTHORS He,X.J., Jiang,X.T., Ma,Y.Y., Xia,Y.J., Wang,H.J., Guan,T.P.,
Shao,Q.S. and Tao,H.Q.
TITLE REG4 contributes to the invasiveness of pancreatic cancer by
upregulating MMP-7 and MMP-9
JOURNAL Cancer Sci. 103 (12), 2082-2091 (2012)
PUBMED 22957785
REMARK GeneRIF: REG4 promotes not only growth but also in vitro
invasiveness of pancreatic cancer cells by upregulating MMP-7 and
MMP-9.
REFERENCE 3 (bases 1 to 1517)
AUTHORS Katsuno,Y., Ehata,S., Yashiro,M., Yanagihara,K., Hirakawa,K. and
Miyazono,K.
TITLE Coordinated expression of REG4 and aldehyde dehydrogenase 1
regulating tumourigenic capacity of diffuse-type gastric
carcinoma-initiating cells is inhibited by TGF-beta
JOURNAL J. Pathol. 228 (3), 391-404 (2012)
PUBMED 22430847
REMARK GeneRIF: TGF-beta signalling reduces the expression of ALDH1 and
REG4, and the size of the ALDH1+ cell population.
REFERENCE 4 (bases 1 to 1517)
AUTHORS Naito,Y., Oue,N., Hinoi,T., Sakamoto,N., Sentani,K., Ohdan,H.,
Yanagihara,K., Sasaki,H. and Yasui,W.
TITLE Reg IV is a direct target of intestinal transcriptional factor CDX2
in gastric cancer
JOURNAL PLoS ONE 7 (11), E47545 (2012)
PUBMED 23133598
REMARK GeneRIF: CDX2 protein directly regulates Reg IV expression in
gastric cancer
REFERENCE 5 (bases 1 to 1517)
AUTHORS Wang,Q., Deng,J., Yuan,J., Wang,L., Zhao,Z., He,S., Zhang,Y. and
Tu,Y.
TITLE Oncogenic reg IV is a novel prognostic marker for glioma patient
survival
JOURNAL Diagn Pathol 7, 69 (2012)
PUBMED 22713481
REMARK GeneRIF: Suggest that Reg IV might accelerate disease progression
and act as a candidate prognostic marker for gliomas.
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 1517)
AUTHORS Zhang,Z. and Henzel,W.J.
TITLE Signal peptide prediction based on analysis of experimentally
verified cleavage sites
JOURNAL Protein Sci. 13 (10), 2819-2824 (2004)
PUBMED 15340161
REFERENCE 7 (bases 1 to 1517)
AUTHORS Zhang,Y., Lai,M., Lv,B., Gu,X., Wang,H., Zhu,Y., Zhu,Y., Shao,L.
and Wang,G.
TITLE Overexpression of Reg IV in colorectal adenoma
JOURNAL Cancer Lett. 200 (1), 69-76 (2003)
PUBMED 14550954
REMARK GeneRIF: overexpression of Reg IV may be an early event in
colorectal carcinogenesis.
REFERENCE 8 (bases 1 to 1517)
AUTHORS Kamarainen,M., Heiskala,K., Knuutila,S., Heiskala,M., Winqvist,O.
and Andersson,L.C.
TITLE RELP, a novel human REG-like protein with up-regulated expression
in inflammatory and metaplastic gastrointestinal mucosa
JOURNAL Am. J. Pathol. 163 (1), 11-20 (2003)
PUBMED 12819006
REMARK GeneRIF: Results suggest that RELP might be involved in
inflammatory and metaplastic responses of the gastrointestinal
epithelium.
REFERENCE 9 (bases 1 to 1517)
AUTHORS Violette,S., Festor,E., Pandrea-Vasile,I., Mitchell,V., Adida,C.,
Dussaulx,E., Lacorte,J.M., Chambaz,J., Lacasa,M. and Lesuffleur,T.
TITLE Reg IV, a new member of the regenerating gene family, is
overexpressed in colorectal carcinomas
JOURNAL Int. J. Cancer 103 (2), 185-193 (2003)
PUBMED 12455032
REFERENCE 10 (bases 1 to 1517)
AUTHORS Hartupee,J.C., Zhang,H., Bonaldo,M.F., Soares,M.B. and
Dieckgraefe,B.K.
TITLE Isolation and characterization of a cDNA encoding a novel member of
the human regenerating protein family: Reg IV
JOURNAL Biochim. Biophys. Acta 1518 (3), 287-293 (2001)
PUBMED 11311942
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AL359752.11 and AY126670.1.
Transcript Variant: This variant (1) is the longest transcript and
encodes the longer isoform (1).
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AY126670.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025085, ERS025090 [ECO:0000350]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-49 AL359752.11 21061-21109 c
50-1281 AY126670.1 50-1281
1282-1517 AL359752.11 3547-3782 c
FEATURES Location/Qualifiers
source 1..1517
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1p13.1-p12"
gene 1..1517
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/note="regenerating islet-derived family, member 4"
/db_xref="GeneID:83998"
/db_xref="HGNC:22977"
/db_xref="MIM:609846"
exon 1..172
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/inference="alignment:Splign:1.39.8"
variation 142..147
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/replace=""
/replace="aggggc"
/db_xref="dbSNP:3216034"
exon 173..346
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/inference="alignment:Splign:1.39.8"
exon 347..507
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/inference="alignment:Splign:1.39.8"
misc_feature 414..416
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/note="upstream in-frame stop codon"
CDS 441..917
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/note="isoform 1 precursor is encoded by transcript
variant 1; regenerating gene type IV; gastrointestinal
secretory protein; regenerating islet-derived protein 4;
REG-4; reg IV; REG-like protein; regenerating
islet-derived protein IV"
/codon_start=1
/product="regenerating islet-derived protein 4 isoform 1
precursor"
/protein_id="NP_001152824.1"
/db_xref="GI:226823233"
/db_xref="CCDS:CCDS906.1"
/db_xref="GeneID:83998"
/db_xref="HGNC:22977"
/db_xref="MIM:609846"
/translation="
MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
"
sig_peptide 441..506
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
mat_peptide 507..914
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/product="Regenerating islet-derived protein 4"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9BYZ8.1)"
misc_feature 528..908
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/note="C-type lectin-like domain (CTLD) of the type found
in Human REG-1 (lithostathine), REG-4, and avian
eggshell-specific proteins: ansocalcin,
structhiocalcin-1(SCA-1), and -2(SCA-2); Region:
CLECT_REG-1_like; cd03594"
/db_xref="CDD:153064"
misc_feature 732..749
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9BYZ8.1);
Region: Carbohydrate-binding"
misc_feature order(819..821,864..869)
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/note="ligand binding surface [chemical binding]; other
site"
/db_xref="CDD:153064"
misc_feature 843..851
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9BYZ8.1);
Region: Carbohydrate-binding"
exon 508..605
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/inference="alignment:Splign:1.39.8"
exon 606..743
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/inference="alignment:Splign:1.39.8"
exon 744..849
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/inference="alignment:Splign:1.39.8"
exon 850..1517
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/inference="alignment:Splign:1.39.8"
variation 1373
/gene="REG4"
/gene_synonym="GISP; REG-IV; RELP"
/replace="a"
/replace="g"
/db_xref="dbSNP:1052972"
ORIGIN
ataagacttttatggatggattgtttttctcaaataatattatcgctttgtgactaaagtaaagattattaattcctgaggcaagaagatataaaagctccagaaacgttgactgggaccactggagacactgaagaaggcaggggcccttagagtcttggttgccaaacagaatgcccatatccgtcttacctgtgaggaagcttgccttgggcgccctctgctggccctcctgaagctaacaggggcgagtgctcggtggtttacaaattgcctccatgcagactatgaaactgttcagcctgctatagttagatctctggcactggcccaggaggtcttgcagatttgcagatcaaggagaacccaggagtttcaaagaagcgctagtaaggtctctgagatccttgcactagctacatcctcagggtaggaggaagatggcttccagaagcatgcggctgctcctattgctgagctgcctggccaaaacaggagtcctgggtgatatcatcatgagacccagctgtgctcctggatggttttaccacaagtccaattgctatggttacttcaggaagctgaggaactggtctgatgccgagctcgagtgtcagtcttacggaaacggagcccacctggcatctatcctgagtttaaaggaagccagcaccatagcagagtacataagtggctatcagagaagccagccgatatggattggcctgcacgacccacagaagaggcagcagtggcagtggattgatggggccatgtatctgtacagatcctggtctggcaagtccatgggtgggaacaagcactgtgctgagatgagctccaataacaactttttaacttggagcagcaacgaatgcaacaagcgccaacacttcctgtgcaagtaccgaccatagagcaagaatcaagattctgctaactcctgcacagccccgtcctcttcctttctgctagcctggctaaatctgctcattatttcagaggggaaacctagcaaactaagagtgataagggccctactacactggcttttttaggcttagagacagaaactttagcattggcccagtagtggcttctagctctaaatgtttgccccgccatccctttccacagtatccttcttccctcctcccctgtctctggctgtctcgagcagtctagaagagtgcatctccagcctatgaaacagctgggtctttggccataagaagtaaagatttgaagacagaaggaagaaactcaggagtaagcttctagaccccttcagcttctacacccttctgccctctctccattgcctgcaccccaccccagccactcaactcctgcttgtttttcctttggccatgggaaggtttaccagtagaatccttgctaggttgatgtgggccatacattcctttaataaaccattgtgtacataagaggttgctgtgttccagttcagtaatggtgaatgtggaaaagtgaaataagaccaagaaatacaccca
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:83998 -> Molecular function: GO:0030246 [carbohydrate binding] evidence: IEA
GeneID:83998 -> Cellular component: GO:0005576 [extracellular region] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.