GGRNA Home | Help | Advanced search

2025-05-09 19:12:12, GGRNA : RefSeq release 60 (20130726)

LOCUS       XM_003960846            1419 bp    mRNA    linear   PRI 30-OCT-2012
DEFINITION  PREDICTED: Homo sapiens double homeobox 4 like 2 (DUX4L2), mRNA.
ACCESSION   XM_003960846
VERSION     XM_003960846.1  GI:410173867
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_004078960) annotated using gene prediction method: GNOMON.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: NCBI
            Annotation Status   :: Full annotation
            Annotation Version  :: Homo sapiens Annotation Release 104
            Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline
            Annotation Method   :: Best-placed RefSeq; Gnomon
            Features Annotated  :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1419
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="Unknown"
                     /cell_line="CHM1htert"
                     /tissue_type="hydatidiform mole"
                     /note="haploid cell line"
     gene            1..1419
                     /gene="DUX4L2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GNOMON. Supporting evidence
                     includes similarity to: 5 Proteins"
                     /db_xref="GeneID:728410"
                     /db_xref="HGNC:37267"
     CDS             1..1419
                     /gene="DUX4L2"
                     /codon_start=1
                     /transl_except=(pos:229..231,aa:OTHER)
                     /transl_except=(pos:637..639,aa:OTHER)
                     /transl_except=(pos:1384..1386,aa:OTHER)
                     /product="LOW QUALITY PROTEIN: double homeobox 4 like 2"
                     /protein_id="XP_003960895.1"
                     /db_xref="GI:410173868"
                     /db_xref="GeneID:728410"
                     /db_xref="HGNC:37267"
                     /translation="
MKWWSLPACGPLKNRWLAVREGLLAAHSSVHRPAEVHGSPPTSLCPCPSVKFWPGLPVMALPILPDSTLPAEARGRXRQRRLVWTPSQSEAQQACFERNPYPGMATRERLAQSIGIPEPWVQIWFQNERSCHLRQHRRESQLWPGRRCLQEGRQKRTAITGSQTALLRALEKDRFAGIAAREELARETGLLESRIQIWFQNRRARHPCRQAAXPSQAGSLCNTAPGRCHPAPSCGALAHTGAWRTRLXAPHVPCTPGALPQGVFLSQGAKAVPVLQPSQAXPAEGISQPYPERGDIAYAALAPPEGALSHPQAPQWPPHLGKTKENRDLQCDALPGPCAVGQPGPLXVLAPPVSQGSPWWVWGRGPQVAXGGWDPQAEAAPPRLPVPPEASVWQGQMLGIPAASQALQEPGRSSALPSGLLLDELLARAEFLQQAQTFLETEAPGDLEDFEEAASLEAPRSXEEYRALLEEL
"
     misc_feature    232..408
                     /gene="DUX4L2"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(232..246,250..252,301..303,319..321,358..360,
                     364..369,376..381,385..393,397..402)
                     /gene="DUX4L2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(238..240,247..249,367..369,376..381,388..390)
                     /gene="DUX4L2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     misc_feature    457..618
                     /gene="DUX4L2"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(457..471,475..477,523..525,541..543,580..582,
                     586..591,598..603,607..615)
                     /gene="DUX4L2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(463..465,472..474,589..591,598..603,610..612)
                     /gene="DUX4L2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
ORIGIN      
atgaagtggtggagcctgcctgcctgtgggcctttaaagaaccgctggctggctgtccgggaaggccttctggctgcacattcctcagtgcacaggccggctgaggtgcacgggagccctccgacctctctctgcccatgtccttccgtgaaattctggccggggctccccgtgatggccctcccgatacttccggacagcaccctccctgcagaagcccggggacggtgacggcaaaggagactcgtttggaccccgagccaaagtgaggcccagcaagcctgctttgagcggaacccatacccgggcatggccaccagagaacggctggcccagtccatcggcattccggagccttgggtccagatttggtttcagaatgagaggtcatgccacctgaggcagcaccggcgggaatctcagctctggccagggagacgctgcctgcaagaaggcaggcagaagcggactgccatcaccggatcccagaccgcccttctccgagccttggagaaggatcgctttgcaggcatcgctgccagggaagagctggccagagagacaggcctcctggagtccaggattcagatctggtttcagaatcgaagggccaggcacccttgcaggcaggcggcctaaccttcgcaggcaggcagcctgtgcaacacggcccccggcaggtgtcaccctgctccctcatgtggcgccctcgcacacactggcgcatggagaacgcggcttnctgcaccccacgtgccctgcacgcctggtgctctcccacagggggttttcttgagccagggagcaaaggccgtccccgtgctccagcccagccaggccnagccggctgaggggatctcccaaccttacccagaacgtggggatattgcctatgctgccctggctcctccagaaggggcgctatcccaccctcaggctcctcagtggcctccgcacctgggcaaaaccaaggagaaccgggacctgcagtgcgatgccctgccgggtccttgcgcggtgggacagcctggcccgctcnaagtgcttgcgccacctgtgtcccaggggagtccatggtgggtctggggccggggtccccaggtcgccntgggtgggtgggatccccaagccgaggcagctccacctcgcctgcccgtgcccccggaggcctccgtgtggcaggggcagatgctaggcatcccggcagcctcccaggcgctccaggagccggggcgttcttctgcactcccctccggcctgctgctggatgagctccttgcgagagcagagtttctgcagcaagcgcaaactttcctagaaacggaggccccgggggacctggaggacttcgaagaggccgcatcactggaagcaccccgcagctaggaggaataccgggctctgctggaggagctttag
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:728410 -> Molecular function: GO:0000976 [transcription regulatory region sequence-specific DNA binding] evidence: IEA
            GeneID:728410 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:728410 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
            GeneID:728410 -> Cellular component: GO:0005634 [nucleus] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.