GGRNA Home | Help | Advanced search

2025-05-09 20:18:54, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_198479               1839 bp    mRNA    linear   PRI 18-APR-2013
DEFINITION  Homo sapiens tetra-peptide repeat homeobox 1 (TPRX1), mRNA.
ACCESSION   NM_198479 XM_209160
VERSION     NM_198479.2  GI:72004268
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1839)
  AUTHORS   Booth,H.A. and Holland,P.W.
  TITLE     Annotation, nomenclature and evolution of four novel homeobox genes
            expressed in the human germ line
  JOURNAL   Gene 387 (1-2), 7-14 (2007)
   PUBMED   17005330
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. This record has been curated by NCBI staff in
            collaboration with Anne Booth and Peter Holland. The reference
            sequence was derived from AK097640.1 and AC008745.7.
            On Aug 9, 2005 this sequence version replaced gi:38348273.
            
            Summary: Homeobox genes encode DNA-binding proteins, many of which
            are thought to be involved in early embryonic development. Homeobox
            genes encode a DNA-binding domain of 60 to 63 amino acids referred
            to as the homeodomain. This gene is a member of the TPRX homeobox
            gene family. [provided by RefSeq, Jul 2008].
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK097640.1, BC137501.1 [ECO:0000332]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-664               AK097640.1         1-664
            665-982             AC008745.7         82314-82631         c
            983-1839            AK097640.1         983-1839
FEATURES             Location/Qualifiers
     source          1..1839
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19q13.33"
     gene            1..1839
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /note="tetra-peptide repeat homeobox 1"
                     /db_xref="GeneID:284355"
                     /db_xref="HGNC:32174"
                     /db_xref="MIM:611166"
     exon            1..101
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /inference="alignment:Splign:1.39.8"
     STS             47..1535
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /db_xref="UniSTS:484610"
     CDS             72..1307
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /note="CRX like homeobox 2"
                     /codon_start=1
                     /product="tetra-peptide repeat homeobox protein 1"
                     /protein_id="NP_940881.2"
                     /db_xref="GI:72004269"
                     /db_xref="CCDS:CCDS33066.1"
                     /db_xref="GeneID:284355"
                     /db_xref="HGNC:32174"
                     /db_xref="MIM:611166"
                     /translation="
MLSLREQQLQVWFKNRRAKLARERRLQQQPQRVPGQRGRGARAAPLVPAASASAPQRGPSGILPAAEPTICSLHQAWGGPGCRAQKGIPAALSPGPGPIPAPIPGPAQIPGPLPGSIPGPIPGPAQIPSPIPAPIPGPISGPVQIPGPFRGPIPGPISGPAPIPGPISGPFSGPNPGPIPGPNPGPIPGPISGPIPGPISVPIPGPIPGPISGPISGPNPGPIPGPIPGPISGPNPGPIPGPISGPNPGLIPGPIPGPISGPGPIIGPIPSPAQIPGPGRLQGPGPILSPGRMRSPGSLPGLAPILGPGSGPGSGSVPAPIPGPGSLPAPAPLWPQSPDASDFLPDTQLFPHFTELLLPLDPLEGSSVSTMTSQYQEGDDSMGKKHSGSQPQEEGGSVNENHSGPRLLLDL
"
     misc_feature    <72..128
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cl00084"
                     /db_xref="CDD:206827"
     exon            102..1839
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(146)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369852848"
     variation       complement(195)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201011037"
     variation       complement(217)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372428024"
     variation       complement(220)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368212934"
     variation       complement(230)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376503531"
     variation       complement(264)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371520931"
     variation       complement(306)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192981266"
     variation       complement(353)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79095323"
     variation       complement(398)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:78495380"
     variation       complement(413)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:373664219"
     variation       complement(415)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200298858"
     variation       complement(420)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370182492"
     variation       complement(421)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377736385"
     variation       complement(457)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368609917"
     variation       complement(489)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186546378"
     variation       complement(496)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374758807"
     variation       complement(513)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183700357"
     variation       complement(536)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192305541"
     variation       complement(553)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202132729"
     variation       complement(556)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201365245"
     variation       complement(605)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:77880834"
     variation       complement(608)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:79291962"
     variation       complement(641)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373180393"
     variation       complement(644)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368987764"
     variation       complement(645)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200053895"
     variation       complement(665)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:78381908"
     variation       complement(669)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201483839"
     variation       complement(673)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200748871"
     variation       complement(677)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:116460612"
     variation       complement(679)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200115895"
     variation       complement(685)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73036913"
     variation       complement(688)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:62130758"
     variation       complement(689)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112397458"
     variation       complement(693)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112842028"
     variation       complement(705)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="ccaggcccaatctcaggcccgatcc"
                     /replace="t"
                     /db_xref="dbSNP:372678982"
     variation       complement(705)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201640420"
     variation       complement(713)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:62130757"
     variation       complement(717..718)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace=""
                     /replace="caggcccaatct"
                     /db_xref="dbSNP:372409362"
     variation       complement(717)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201007421"
     variation       complement(736)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199739873"
     variation       complement(737)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147608412"
     variation       complement(741)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201315320"
     variation       complement(749)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12461263"
     variation       complement(753)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145255760"
     variation       complement(772)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199789805"
     variation       complement(773)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12463317"
     variation       complement(775)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200474965"
     variation       complement(784)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147380237"
     variation       complement(785)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371001974"
     variation       complement(789)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:75909117"
     variation       complement(833)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368906904"
     variation       complement(864)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145047883"
     variation       complement(866)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:141084241"
     variation       complement(923)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374893692"
     variation       complement(945)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201517173"
     variation       complement(946)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376802611"
     variation       complement(950)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373591593"
     variation       complement(960)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375583239"
     variation       complement(982)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:77144450"
     variation       complement(999)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:115615918"
     variation       complement(1019)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184210020"
     variation       complement(1020)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191563892"
     variation       complement(1033)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:148675311"
     variation       complement(1060)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:144013839"
     variation       complement(1067)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149923413"
     variation       complement(1068)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139632837"
     variation       complement(1085)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369241122"
     variation       complement(1086)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146319990"
     variation       complement(1094)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:115054462"
     variation       complement(1095)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188760456"
     variation       complement(1123)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182909068"
     variation       complement(1125)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190300469"
     variation       complement(1134)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201385619"
     variation       complement(1148)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373838085"
     variation       complement(1189)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138810035"
     variation       complement(1204)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200857503"
     variation       complement(1245)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202204190"
     variation       complement(1263)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200596763"
     variation       complement(1289)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150702728"
     variation       complement(1292)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141998894"
     variation       complement(1334)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:35445888"
     variation       complement(1358)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373102507"
     variation       complement(1432)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111411093"
     variation       complement(1448)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12463168"
     variation       complement(1479)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185195565"
     variation       complement(1505)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:372442580"
     variation       complement(1594)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12462695"
     variation       complement(1639)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12462705"
     variation       complement(1654)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:180916862"
     variation       complement(1655)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190016879"
     variation       complement(1793)
                     /gene="TPRX1"
                     /gene_synonym="TPRX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:187182076"
ORIGIN      
agaaagtgctagaattttactttcagaaggaccagtacccgaactacgaccagcgactgaatctggcggagatgctcagcctcagggagcaacagctgcaggtgtggttcaagaatcgccgcgccaaactagctcgggagcggcggctccagcagcagccccagcgcgtccctgggcagagaggccgaggagcccgcgctgcgcccctagtccctgcagcctctgcctccgcacctcagcggggcccctcgggaatccttccagcggcggaacccacgatctgcagcctccaccaggcctggggtggccctgggtgcagagcccagaagggcatcccagctgccctgagtccaggccctggcccgatccctgccccaatcccaggcccagcccagatcccaggcccactccctggctcaattccaggcccaattccaggcccagctcagatcccaagcccgatcccagccccaatcccaggcccaatttcaggcccagtccagatcccaggcccattccgtggcccaatcccaggcccaatttcaggcccagccccgatcccaggcccaatctcaggcccattctcaggcccaaacccaggcccgatcccaggcccaaacccaggcccgatcccaggcccaatctcaggcccgatcccaggcccaatctcagtcccgatcccaggcccgatcccaggcccaatctcaggcccaatctcaggcccaaacccaggcccgatcccaggcccaatcccaggcccaatctcaggcccgaacccaggcccgatcccaggcccaatctcaggcccgaacccaggcctgatcccaggcccaatcccaggcccaatctcaggcccaggcccaattataggcccgattcccagcccagcccagatcccaggcccaggcagactccaaggcccaggtcccatcttaagtcctggccggatgcgaagccctggctcacttccaggcctagccccgattttaggcccaggctcaggcccaggctcaggctcagtcccagctccaatcccaggcccaggatcactcccagccccagcccccttatggcctcagagccccgatgcctccgacttcttgccagacacccagttattccctcacttcacagagctgctcctacccctagaccccttggagggatcctcagtctccaccatgacctctcagtaccaagaaggggatgactctatgggcaaaaaacactcagggtctcagccccaagaggagggtggctctgtgaatgaaaatcactcaggccccaggttattactggatttatagggggcctgtgcctgcaaagttcttcagatcccagagggcctggagtggctgatctacactgctggtgactttctgcagtgaatgcatcaccctttacccaccctgctgcaggtggacatttgctgtcttcactgtgcagctatcacaggtggctctgctgtgaatgtgcctgcctgtcatttgaattgagcctgagcgtttctctgctgggattggagtcgctgctcactgggatatctggcattagtggatgctgctcgagagctttctaaagggcttttcccagggcttctgatggtcagcatcttccccaacacttaggattgtgagactttttaatgtttgtcgatccaatgacttgtggttttgttgtggttgtaatatccatttccctgatgattgagaagttaaaccctcacatgttaattgaaccttagatatcttcataatgtgtatttgtttaccccttttccttcatttatttgaatgtattcttatattctcttggcaattaaagttctgcagacacctt
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:284355 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:284355 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:284355 -> Cellular component: GO:0005634 [nucleus] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.