Home |
Help |
Advanced search
2025-05-09 20:18:54, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_198479 1839 bp mRNA linear PRI 18-APR-2013 DEFINITION Homo sapiens tetra-peptide repeat homeobox 1 (TPRX1), mRNA. ACCESSION NM_198479 XM_209160 VERSION NM_198479.2 GI:72004268 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1839) AUTHORS Booth,H.A. and Holland,P.W. TITLE Annotation, nomenclature and evolution of four novel homeobox genes expressed in the human germ line JOURNAL Gene 387 (1-2), 7-14 (2007) PUBMED 17005330 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. This record has been curated by NCBI staff in collaboration with Anne Booth and Peter Holland. The reference sequence was derived from AK097640.1 and AC008745.7. On Aug 9, 2005 this sequence version replaced gi:38348273. Summary: Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the TPRX homeobox gene family. [provided by RefSeq, Jul 2008]. ##Evidence-Data-START## Transcript exon combination :: AK097640.1, BC137501.1 [ECO:0000332] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-664 AK097640.1 1-664 665-982 AC008745.7 82314-82631 c 983-1839 AK097640.1 983-1839 FEATURES Location/Qualifiers source 1..1839 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="19" /map="19q13.33" gene 1..1839 /gene="TPRX1" /gene_synonym="TPRX" /note="tetra-peptide repeat homeobox 1" /db_xref="GeneID:284355" /db_xref="HGNC:32174" /db_xref="MIM:611166" exon 1..101 /gene="TPRX1" /gene_synonym="TPRX" /inference="alignment:Splign:1.39.8" STS 47..1535 /gene="TPRX1" /gene_synonym="TPRX" /db_xref="UniSTS:484610" CDS 72..1307 /gene="TPRX1" /gene_synonym="TPRX" /note="CRX like homeobox 2" /codon_start=1 /product="tetra-peptide repeat homeobox protein 1" /protein_id="NP_940881.2" /db_xref="GI:72004269" /db_xref="CCDS:CCDS33066.1" /db_xref="GeneID:284355" /db_xref="HGNC:32174" /db_xref="MIM:611166" /translation="
MLSLREQQLQVWFKNRRAKLARERRLQQQPQRVPGQRGRGARAAPLVPAASASAPQRGPSGILPAAEPTICSLHQAWGGPGCRAQKGIPAALSPGPGPIPAPIPGPAQIPGPLPGSIPGPIPGPAQIPSPIPAPIPGPISGPVQIPGPFRGPIPGPISGPAPIPGPISGPFSGPNPGPIPGPNPGPIPGPISGPIPGPISVPIPGPIPGPISGPISGPNPGPIPGPIPGPISGPNPGPIPGPISGPNPGLIPGPIPGPISGPGPIIGPIPSPAQIPGPGRLQGPGPILSPGRMRSPGSLPGLAPILGPGSGPGSGSVPAPIPGPGSLPAPAPLWPQSPDASDFLPDTQLFPHFTELLLPLDPLEGSSVSTMTSQYQEGDDSMGKKHSGSQPQEEGGSVNENHSGPRLLLDL
"
misc_feature <72..128
/gene="TPRX1"
/gene_synonym="TPRX"
/note="Homeodomain; DNA binding domains involved in the
transcriptional regulation of key eukaryotic developmental
processes; may bind to DNA as monomers or as homo- and/or
heterodimers, in a sequence-specific manner; Region:
homeodomain; cl00084"
/db_xref="CDD:206827"
exon 102..1839
/gene="TPRX1"
/gene_synonym="TPRX"
/inference="alignment:Splign:1.39.8"
variation complement(146)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:369852848"
variation complement(195)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:201011037"
variation complement(217)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:372428024"
variation complement(220)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="g"
/db_xref="dbSNP:368212934"
variation complement(230)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:376503531"
variation complement(264)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:371520931"
variation complement(306)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:192981266"
variation complement(353)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:79095323"
variation complement(398)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="c"
/db_xref="dbSNP:78495380"
variation complement(413)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="t"
/db_xref="dbSNP:373664219"
variation complement(415)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="g"
/db_xref="dbSNP:200298858"
variation complement(420)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:370182492"
variation complement(421)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:377736385"
variation complement(457)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:368609917"
variation complement(489)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:186546378"
variation complement(496)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="g"
/db_xref="dbSNP:374758807"
variation complement(513)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:183700357"
variation complement(536)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:192305541"
variation complement(553)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:202132729"
variation complement(556)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="c"
/db_xref="dbSNP:201365245"
variation complement(605)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:77880834"
variation complement(608)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="c"
/db_xref="dbSNP:79291962"
variation complement(641)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:373180393"
variation complement(644)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:368987764"
variation complement(645)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:200053895"
variation complement(665)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:78381908"
variation complement(669)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:201483839"
variation complement(673)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="g"
/replace="t"
/db_xref="dbSNP:200748871"
variation complement(677)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="g"
/db_xref="dbSNP:116460612"
variation complement(679)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="t"
/db_xref="dbSNP:200115895"
variation complement(685)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:73036913"
variation complement(688)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:62130758"
variation complement(689)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:112397458"
variation complement(693)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:112842028"
variation complement(705)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="ccaggcccaatctcaggcccgatcc"
/replace="t"
/db_xref="dbSNP:372678982"
variation complement(705)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:201640420"
variation complement(713)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:62130757"
variation complement(717..718)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace=""
/replace="caggcccaatct"
/db_xref="dbSNP:372409362"
variation complement(717)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:201007421"
variation complement(736)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:199739873"
variation complement(737)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:147608412"
variation complement(741)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:201315320"
variation complement(749)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:12461263"
variation complement(753)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:145255760"
variation complement(772)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:199789805"
variation complement(773)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:12463317"
variation complement(775)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="t"
/db_xref="dbSNP:200474965"
variation complement(784)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:147380237"
variation complement(785)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:371001974"
variation complement(789)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:75909117"
variation complement(833)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:368906904"
variation complement(864)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:145047883"
variation complement(866)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="g"
/replace="t"
/db_xref="dbSNP:141084241"
variation complement(923)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:374893692"
variation complement(945)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:201517173"
variation complement(946)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:376802611"
variation complement(950)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:373591593"
variation complement(960)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="g"
/replace="t"
/db_xref="dbSNP:375583239"
variation complement(982)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:77144450"
variation complement(999)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:115615918"
variation complement(1019)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:184210020"
variation complement(1020)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:191563892"
variation complement(1033)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="t"
/db_xref="dbSNP:148675311"
variation complement(1060)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="g"
/db_xref="dbSNP:144013839"
variation complement(1067)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:149923413"
variation complement(1068)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:139632837"
variation complement(1085)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:369241122"
variation complement(1086)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:146319990"
variation complement(1094)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:115054462"
variation complement(1095)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:188760456"
variation complement(1123)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:182909068"
variation complement(1125)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:190300469"
variation complement(1134)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:201385619"
variation complement(1148)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:373838085"
variation complement(1189)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="g"
/db_xref="dbSNP:138810035"
variation complement(1204)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:200857503"
variation complement(1245)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:202204190"
variation complement(1263)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:200596763"
variation complement(1289)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="g"
/replace="t"
/db_xref="dbSNP:150702728"
variation complement(1292)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:141998894"
variation complement(1334)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="g"
/replace="t"
/db_xref="dbSNP:35445888"
variation complement(1358)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="g"
/db_xref="dbSNP:373102507"
variation complement(1432)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:111411093"
variation complement(1448)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:12463168"
variation complement(1479)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:185195565"
variation complement(1505)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="g"
/replace="t"
/db_xref="dbSNP:372442580"
variation complement(1594)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="g"
/replace="t"
/db_xref="dbSNP:12462695"
variation complement(1639)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:12462705"
variation complement(1654)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="c"
/replace="t"
/db_xref="dbSNP:180916862"
variation complement(1655)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="g"
/db_xref="dbSNP:190016879"
variation complement(1793)
/gene="TPRX1"
/gene_synonym="TPRX"
/replace="a"
/replace="t"
/db_xref="dbSNP:187182076"
ORIGIN
agaaagtgctagaattttactttcagaaggaccagtacccgaactacgaccagcgactgaatctggcggagatgctcagcctcagggagcaacagctgcaggtgtggttcaagaatcgccgcgccaaactagctcgggagcggcggctccagcagcagccccagcgcgtccctgggcagagaggccgaggagcccgcgctgcgcccctagtccctgcagcctctgcctccgcacctcagcggggcccctcgggaatccttccagcggcggaacccacgatctgcagcctccaccaggcctggggtggccctgggtgcagagcccagaagggcatcccagctgccctgagtccaggccctggcccgatccctgccccaatcccaggcccagcccagatcccaggcccactccctggctcaattccaggcccaattccaggcccagctcagatcccaagcccgatcccagccccaatcccaggcccaatttcaggcccagtccagatcccaggcccattccgtggcccaatcccaggcccaatttcaggcccagccccgatcccaggcccaatctcaggcccattctcaggcccaaacccaggcccgatcccaggcccaaacccaggcccgatcccaggcccaatctcaggcccgatcccaggcccaatctcagtcccgatcccaggcccgatcccaggcccaatctcaggcccaatctcaggcccaaacccaggcccgatcccaggcccaatcccaggcccaatctcaggcccgaacccaggcccgatcccaggcccaatctcaggcccgaacccaggcctgatcccaggcccaatcccaggcccaatctcaggcccaggcccaattataggcccgattcccagcccagcccagatcccaggcccaggcagactccaaggcccaggtcccatcttaagtcctggccggatgcgaagccctggctcacttccaggcctagccccgattttaggcccaggctcaggcccaggctcaggctcagtcccagctccaatcccaggcccaggatcactcccagccccagcccccttatggcctcagagccccgatgcctccgacttcttgccagacacccagttattccctcacttcacagagctgctcctacccctagaccccttggagggatcctcagtctccaccatgacctctcagtaccaagaaggggatgactctatgggcaaaaaacactcagggtctcagccccaagaggagggtggctctgtgaatgaaaatcactcaggccccaggttattactggatttatagggggcctgtgcctgcaaagttcttcagatcccagagggcctggagtggctgatctacactgctggtgactttctgcagtgaatgcatcaccctttacccaccctgctgcaggtggacatttgctgtcttcactgtgcagctatcacaggtggctctgctgtgaatgtgcctgcctgtcatttgaattgagcctgagcgtttctctgctgggattggagtcgctgctcactgggatatctggcattagtggatgctgctcgagagctttctaaagggcttttcccagggcttctgatggtcagcatcttccccaacacttaggattgtgagactttttaatgtttgtcgatccaatgacttgtggttttgttgtggttgtaatatccatttccctgatgattgagaagttaaaccctcacatgttaattgaaccttagatatcttcataatgtgtatttgtttaccccttttccttcatttatttgaatgtattcttatattctcttggcaattaaagttctgcagacacctt
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:284355 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
GeneID:284355 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
GeneID:284355 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.