LOCUS       NM_178138               2382 bp    mRNA    linear   PRI 15-JUN-2013
DEFINITION  Homo sapiens LIM homeobox 3 (LHX3), transcript variant 1, mRNA.
ACCESSION   NM_178138
VERSION     NM_178138.4  GI:315013528
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2382)
  AUTHORS   Porcu,E., Medici,M., Pistis,G., Volpato,C.B., Wilson,S.G.,
            Cappola,A.R., Bos,S.D., Deelen,J., den Heijer,M., Freathy,R.M.,
            Lahti,J., Liu,C., Lopez,L.M., Nolte,I.M., O'Connell,J.R.,
            Tanaka,T., Trompet,S., Arnold,A., Bandinelli,S., Beekman,M.,
            Bohringer,S., Brown,S.J., Buckley,B.M., Camaschella,C., de
            Craen,A.J., Davies,G., de Visser,M.C., Ford,I., Forsen,T.,
            Frayling,T.M., Fugazzola,L., Gogele,M., Hattersley,A.T.,
            Hermus,A.R., Hofman,A., Houwing-Duistermaat,J.J., Jensen,R.A.,
            Kajantie,E., Kloppenburg,M., Lim,E.M., Masciullo,C., Mariotti,S.,
            Minelli,C., Mitchell,B.D., Nagaraja,R., Netea-Maier,R.T.,
            Palotie,A., Persani,L., Piras,M.G., Psaty,B.M., Raikkonen,K.,
            Richards,J.B., Rivadeneira,F., Sala,C., Sabra,M.M., Sattar,N.,
            Shields,B.M., Soranzo,N., Starr,J.M., Stott,D.J., Sweep,F.C.,
            Usala,G., van der Klauw,M.M., van Heemst,D., van Mullem,A.,
            Vermeulen,S.H., Visser,W.E., Walsh,J.P., Westendorp,R.G., Widen,E.,
            Zhai,G., Cucca,F., Deary,I.J., Eriksson,J.G., Ferrucci,L.,
            Fox,C.S., Jukema,J.W., Kiemeney,L.A., Pramstaller,P.P.,
            Schlessinger,D., Shuldiner,A.R., Slagboom,E.P., Uitterlinden,A.G.,
            Vaidya,B., Visser,T.J., Wolffenbuttel,B.H., Meulenbelt,I.,
            Rotter,J.I., Spector,T.D., Hicks,A.A., Toniolo,D., Sanna,S.,
            Peeters,R.P. and Naitza,S.
  TITLE     A meta-analysis of thyroid-related traits reveals novel loci and
            gender-specific differences in the regulation of thyroid function
  JOURNAL   PLoS Genet. 9 (2), E1003266 (2013)
   PUBMED   23408906
REFERENCE   2  (bases 1 to 2382)
  AUTHORS   Fujihara,J., Takeshita,H., Kimura-Kataoka,K., Yuasa,I., Iida,R.,
            Ueki,M., Nagao,M., Kominato,Y. and Yasuda,T.
  TITLE     Replication study of the association of SNPs in the LHX3-QSOX2 and
            IGF1 loci with adult height in the Japanese population;
            wide-ranging comparison of each SNP genotype distribution
  JOURNAL   Leg Med (Tokyo) 14 (4), 205-208 (2012)
   PUBMED   22503243
  REMARK    GeneRIF: The present study was unable to confirm a significant
            association of all of the three SNPs, rs12338076 in LHX3-QSOX2, and
            rs1457595 and rs17032362 in IGF1, with adult height in our study
            population.
REFERENCE   3  (bases 1 to 2382)
  AUTHORS   Bechtold-Dalla Pozza,S., Hiedl,S., Roeb,J., Lohse,P., Malik,R.E.,
            Park,S., Duran-Prado,M. and Rhodes,S.J.
  TITLE     A recessive mutation resulting in a disabling amino acid
            substitution (T194R) in the LHX3 homeodomain causes combined
            pituitary hormone deficiency
  JOURNAL   Horm Res Paediatr 77 (1), 41-51 (2012)
   PUBMED   22286346
  REMARK    GeneRIF: descriprion of pediatric patients with combined pituitary
            hormone deficiency with a novel mutation in LHX3; the T194R
            mutation affects a critical residue in the LHX3 protein; study
            extends understanding of phenotypic features, molecular mechanism
            and developmental course associated with mutations in the LHX3 gene
REFERENCE   4  (bases 1 to 2382)
  AUTHORS   Yaden,B.C., Garcia,M. III, Smith,T.P. and Rhodes,S.J.
  TITLE     Two promoters mediate transcription from the human LHX3 gene:
            involvement of nuclear factor I and specificity protein 1
  JOURNAL   Endocrinology 147 (1), 324-337 (2006)
   PUBMED   16179410
  REMARK    GeneRIF: Specificity protein 1 is a regulator of both promoters
            through interaction with GC boxes and also, a distal element within
            intron 1a that is recognized by nuclear factor I is critical for
            hLHX3b promoter function.
REFERENCE   5  (bases 1 to 2382)
  AUTHORS   Sloop,K.W., Dwyer,C.J. and Rhodes,S.J.
  TITLE     An isoform-specific inhibitory domain regulates the LHX3 LIM
            homeodomain factor holoprotein and the production of a functional
            alternate translation form
  JOURNAL   J. Biol. Chem. 276 (39), 36311-36319 (2001)
   PUBMED   11470784
  REMARK    GeneRIF: The Lhx3 gene encodes two isoforms, LHX3a and LHX3b, that
            differ in their amino-terminal sequences. A novel LHX3 protein
            (M2-LHX3) is identified and it is determined that this molecule is
            generated by an internal translation initiation codon.
REFERENCE   6  (bases 1 to 2382)
  AUTHORS   Parker,G.E., Sandoval,R.M., Feister,H.A., Bidwell,J.P. and
            Rhodes,S.J.
  TITLE     The homeodomain coordinates nuclear entry of the Lhx3
            neuroendocrine transcription factor and association with the
            nuclear matrix
  JOURNAL   J. Biol. Chem. 275 (31), 23891-23898 (2000)
   PUBMED   10818088
REFERENCE   7  (bases 1 to 2382)
  AUTHORS   Schmitt,S., Biason-Lauber,A., Betts,D. and Schoenle,E.J.
  TITLE     Genomic structure, chromosomal localization, and expression pattern
            of the human LIM-homeobox3 (LHX 3) gene
  JOURNAL   Biochem. Biophys. Res. Commun. 274 (1), 49-56 (2000)
   PUBMED   10903894
REFERENCE   8  (bases 1 to 2382)
  AUTHORS   Sloop,K.W., Showalter,A.D., Von Kap-Herr,C., Pettenati,M.J. and
            Rhodes,S.J.
  TITLE     Analysis of the human LHX3 neuroendocrine transcription factor gene
            and mapping to the subtelomeric region of chromosome 9
  JOURNAL   Gene 245 (2), 237-243 (2000)
   PUBMED   10717474
REFERENCE   9  (bases 1 to 2382)
  AUTHORS   Sloop,K.W., Meier,B.C., Bridwell,J.L., Parker,G.E., Schiller,A.M.
            and Rhodes,S.J.
  TITLE     Differential activation of pituitary hormone genes by human Lhx3
            isoforms with distinct DNA binding properties
  JOURNAL   Mol. Endocrinol. 13 (12), 2212-2225 (1999)
   PUBMED   10598593
REFERENCE   10 (bases 1 to 2382)
  AUTHORS   Jurata,L.W., Pfaff,S.L. and Gill,G.N.
  TITLE     The nuclear LIM domain interactor NLI mediates homo- and
            heterodimerization of LIM domain transcription factors
  JOURNAL   J. Biol. Chem. 273 (6), 3152-3157 (1998)
   PUBMED   9452425
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AF156888.1, AL138781.13,
            BU165468.1 and BM665174.1.
            This sequence is a reference standard in the RefSeqGene project.
            On Dec 14, 2010 this sequence version replaced gi:88999599.
            
            Summary: This gene encodes a member a large protein family which
            carry the LIM domain, a unique cysteine-rich zinc-binding domain.
            The encoded protein is a transcription factor that is required for
            pituitary development and motor neuron specification. Mutations in
            this gene cause combined pituitary hormone deficiency 3.
            Alternative splicing results in multiple transcript variants.
            [provided by RefSeq, Dec 2010].
            
            Transcript Variant: This variant (1) represents the shorter
            transcript. This transcript encodes two proteins; isoform a and
            M2-LHX3, which is generated by an internal translation initiation
            codon.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF156888.1, AB593063.1 [ECO:0000332]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-57                AF156888.1         8-64
            58-58               AL138781.13        114927-114927       c
            59-1802             AF156888.1         66-1809
            1803-1994           BU165468.1         394-585             c
            1995-2337           AF156888.1         1810-2152
            2338-2344           BM665174.1         40-46               c
            2345-2382           BM665174.1         1-38                c
FEATURES             Location/Qualifiers
     source          1..2382
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="9"
                     /map="9q34.3"
     gene            1..2382
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /note="LIM homeobox 3"
                     /db_xref="GeneID:8022"
                     /db_xref="HGNC:6595"
                     /db_xref="MIM:600577"
     exon            1..176
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(58)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:10858245"
     variation       complement(67)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376492105"
     variation       complement(68)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373489983"
     CDS             98..1291
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /note="isoform a is encoded by transcript variant 1;
                     LIM/homeodomain protein LHX3; LIM homeobox protein 3;
                     LIM/homeobox protein Lhx3"
                     /codon_start=1
                     /product="LIM/homeobox protein Lhx3 isoform a"
                     /protein_id="NP_835258.1"
                     /db_xref="GI:30023847"
                     /db_xref="CCDS:CCDS6994.1"
                     /db_xref="GeneID:8022"
                     /db_xref="HGNC:6595"
                     /db_xref="MIM:600577"
                     /translation="

MLLETGLERDRARPGAAAVCTLGGTREIPLCAGCDQHILDRFILKALDRHWHSKCLKCSDCHTPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATAKRPRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGLAGPEQYRELRPGSPYGVPPSPAAPQSLPGPQPLLSSLVYPDTSLGLVPSGAPGGPPPMRVLAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQF

"
     misc_feature    179..343
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /note="The first LIM domain of Lhx3b; Region: LIM1_Lhx3b;
                     cd09467"
                     /db_xref="CDD:188851"
     misc_feature    order(188..190,197..199,251..253,260..262,269..271,
                     278..280,329..331,338..340)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188851"
     misc_feature    284..286
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine; propagated from
                     UniProtKB/Swiss-Prot (Q9UBR4.2); phosphorylation site"
     misc_feature    308..310
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q9UBR4.2); phosphorylation site"
     misc_feature    365..532
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /note="The second LIM domain of Lhx3-Lhx4 family; Region:
                     LIM2_Lhx3_Lhx4; cd09376"
                     /db_xref="CDD:188762"
     misc_feature    order(365..367,374..376,431..433,440..442,449..451,
                     458..460,518..520,527..529)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188762"
     misc_feature    order(401..403,476..478)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /note="Isl binding site; other site"
                     /db_xref="CDD:188762"
     misc_feature    497..499
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /note="Region: alternate start codon, M2-LHX3 isoform"
     misc_feature    569..745
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(569..583,587..589,638..640,656..658,695..697,
                     701..706,713..718,722..730,734..739)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(575..577,584..586,704..706,713..718,725..727)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     misc_feature    776..778
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphotyrosine; propagated from
                     UniProtKB/Swiss-Prot (Q9UBR4.2); phosphorylation site"
     misc_feature    797..799
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q9UBR4.2); phosphorylation site"
     misc_feature    809..811
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q9UBR4.2); phosphorylation site"
     variation       complement(115)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369672206"
     variation       complement(118)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202124276"
     variation       complement(176)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376795779"
     exon            177..348
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(184)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183980824"
     variation       complement(191)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201187873"
     variation       complement(205)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:33998096"
     variation       230
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:137854506"
     variation       complement(242..243)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:143900430"
     variation       complement(275)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146027009"
     variation       complement(295)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:190916587"
     variation       complement(299)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142400016"
     variation       complement(300)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377183234"
     variation       complement(302)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:369098555"
     variation       complement(323)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:137904970"
     exon            349..551
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /inference="alignment:Splign:1.39.8"
     variation       384..385
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="gc"
                     /replace="tcct"
                     /db_xref="dbSNP:137854504"
     variation       complement(404)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150707583"
     variation       429
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:104894117"
     variation       complement(434)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368125309"
     variation       complement(454)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141212140"
     variation       complement(474)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:148212782"
     variation       complement(480)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146827257"
     variation       complement(482)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142521088"
     variation       complement(510)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374047783"
     variation       complement(515)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61735423"
     variation       complement(538)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200521449"
     variation       complement(541)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199597636"
     exon            552..703
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(565)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375736709"
     variation       complement(573)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371115016"
     variation       complement(574)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377336808"
     variation       complement(586)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373260738"
     variation       complement(626)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:7026851"
     variation       complement(694)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:369145566"
     exon            704..872
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /inference="alignment:Splign:1.39.8"
     variation       726
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:137854503"
     variation       complement(765)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200625905"
     variation       769
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:137854505"
     variation       complement(802)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138595537"
     variation       complement(837)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368687418"
     exon            873..2366
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(900)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368394827"
     variation       complement(916)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373923718"
     variation       complement(925)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371660154"
     variation       complement(926)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148996633"
     variation       complement(936)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367560846"
     variation       complement(949)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373829144"
     variation       complement(1016)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:145867977"
     variation       complement(1017)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:182345541"
     variation       complement(1026)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201591640"
     variation       complement(1061)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201356862"
     variation       complement(1176)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370781523"
     variation       complement(1190)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377042655"
     variation       complement(1234)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375094960"
     variation       complement(1236)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368513609"
     variation       complement(1250)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370894783"
     variation       complement(1252)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377653669"
     variation       complement(1253)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373487851"
     variation       complement(1300)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369623778"
     variation       complement(1306)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3180307"
     variation       complement(1345)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149095968"
     variation       complement(1395)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:146678449"
     variation       complement(1416)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188334539"
     variation       complement(1476)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:144976921"
     variation       complement(1621)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:183462431"
     variation       complement(1694..1695)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:35376545"
     variation       complement(1707)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:373406050"
     variation       complement(1747)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150382420"
     variation       complement(1798)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:370582211"
     variation       complement(1808..1809)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:35405434"
     variation       complement(1808)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369945393"
     variation       complement(1870)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:116609362"
     variation       complement(1928)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191713062"
     variation       complement(1929)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374699388"
     variation       complement(1978)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147473033"
     variation       complement(2038)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146752425"
     variation       complement(2064)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148781569"
     variation       complement(2071)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4842130"
     variation       complement(2075)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371238940"
     variation       complement(2082)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12237402"
     variation       complement(2116)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3739470"
     variation       complement(2243)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146829817"
     variation       complement(2253)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371718472"
     variation       complement(2324)
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186885868"
     polyA_signal    2343..2348
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
     polyA_site      2366
                     /gene="LHX3"
                     /gene_synonym="CPHD3; LIM3; M2-LHX3"
ORIGIN      

gccccgcacgacgcggcgggacttgggagccccgaaccctccaggggacgctgacctaggaggagcgcgtctcgcgccactcggcctggtggccgcgatgctgctggaaacggggctcgagcgcgaccgagcgaggcccggggccgccgccgtctgcaccttgggcgggactcgggagatcccgctgtgcgctggctgtgaccagcacatcctggaccgcttcatcctcaaggctctggaccgccactggcacagcaagtgtctcaagtgcagcgactgccacacgccactggccgagcgctgcttcagccgaggggagagcgtttactgcaaggacgactttttcaagcgcttcgggaccaagtgcgccgcgtgccagctgggcatcccgcccacgcaggtggtgcgccgcgcccaggacttcgtgtaccacctgcactgctttgcctgcgtcgtgtgcaagcggcagctggccacgggcgacgagttctacctcatggaggacagccggctcgtgtgcaaggcggactacgaaaccgccaagcagcgagaggccgaggccacggccaagcggccgcgcacgaccatcaccgccaagcagctggagacgctgaagagcgcttacaacacctcgcccaagccggcgcgccacgtgcgcgagcagctctcgtccgagacgggcctggacatgcgcgtggtgcaggtttggttccagaaccgccgggccaaggagaagaggctgaagaaggacgccggccggcagcgctgggggcagtatttccgcaacatgaagcgctcccgcggcggctccaagtcggacaaggacagcgttcaggaggggcaggacagcgacgctgaggtctccttccccgatgagccttccttggcggaaatgggcccggccaatggcctctacgggagcttgggggaacccacccaggccttgggccggccctcgggagccctgggcaacttctccctggagcatggaggcctggcaggcccagagcagtaccgagagctgcgtcccggcagcccctacggtgtccccccatcccccgccgccccgcagagcctccctggcccccagcccctcctctccagcctggtgtacccagacaccagcttgggccttgtgccctcgggagcccccggcgggcccccacccatgagggtgctggcagggaacggacccagttctgacctatccacggggagcagcgggggttaccccgacttccctgccagccccgcctcctggctggatgaggtagaccacgctcagttctgacccaggcccggctccaccctgcacctcacacgagggagctgcccctgggtgggcggctcggggctgctggggtttccgaggaagtggggccagggcgtcaagggagggctggtgccttcggagcctcccactgccgaccgcacagctccctctctgggggctgagggacccacctggcccctcctctgacacagggctggcccgccaggtggcctcccagcaagccagccttttttgtaagcaaatttctcccctttattgaccaattaactgagcacttgctgctatttctagacatgaaatgtcaccttgctgaggcccagcccagcccagcatagcccgagggctggaaaaacgctttcatctctaaaactgagaaatcatcataattgtgctttcacttcccaggctccatgtgtcttggagccgtcaccccgaggctccctctttaggtcggagattggccttgcctgtcgaggcaagaggctgcagaggcggggacacacctgtgtcctccgggagaggccccctcctctccccagaccacagggggcctctctgcctccagccccaccttccccgggagaagctttccccaatccccaggtctctagatcattctgttctcgagtatcctgtggaggaggcaaaaatgcctggcgccccttctctccaagctcaattctctaagcccctcagggtctcctcctcaccccaccccaggcccttggtgtccaggctgcacccacagatgtctgttgccaaacagcctgccctccctgccggagccggctctgccagccccagattgggaagtctccccgctggagaagggtggggctcctctgagcctgccctgcctcctccatcagatcctttgggaagaagtttctgggagatgcccgcagctgtgcgtgccccagacacaaaggctggcctgtgtgtaagtcaaagtcactcccgcaaacctgaatctcgagctacctattggttctgtgaatgttctgtgtcttttatttattctcgggtgatcagctctttccaagacttcaataaatttgtcagttacagtcaaaaaaaaaaaaaaaaaa

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:8022 -> Molecular function: GO:0001076 [RNA polymerase II transcription factor binding transcription factor activity] evidence: IEA
            GeneID:8022 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:8022 -> Molecular function: GO:0008270 [zinc ion binding] evidence: IEA
            GeneID:8022 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:8022 -> Biological process: GO:0001890 [placenta development] evidence: IEA
            GeneID:8022 -> Biological process: GO:0008045 [motor neuron axon guidance] evidence: IEA
            GeneID:8022 -> Biological process: GO:0009887 [organ morphogenesis] evidence: TAS
            GeneID:8022 -> Biological process: GO:0021520 [spinal cord motor neuron cell fate specification] evidence: IEA
            GeneID:8022 -> Biological process: GO:0021521 [ventral spinal cord interneuron specification] evidence: IEA
            GeneID:8022 -> Biological process: GO:0021526 [medial motor column neuron differentiation] evidence: IEA
            GeneID:8022 -> Biological process: GO:0021527 [spinal cord association neuron differentiation] evidence: IEA
            GeneID:8022 -> Biological process: GO:0021983 [pituitary gland development] evidence: IEA
            GeneID:8022 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IEA
            GeneID:8022 -> Biological process: GO:0045893 [positive regulation of transcription, DNA-dependent] evidence: ISS
            GeneID:8022 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IEA
            GeneID:8022 -> Biological process: GO:0048839 [inner ear development] evidence: IEP
            GeneID:8022 -> Cellular component: GO:0005634 [nucleus] evidence: TAS
            GeneID:8022 -> Cellular component: GO:0005667 [transcription factor complex] evidence: IEA