GGRNA Home | Help | Advanced search

2025-05-09 20:25:44, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_152568                551 bp    mRNA    linear   PRI 12-APR-2013
DEFINITION  Homo sapiens NK6 homeobox 3 (NKX6-3), mRNA.
ACCESSION   NM_152568
VERSION     NM_152568.2  GI:90962997
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 551)
  AUTHORS   Alanentalo,T., Chatonnet,F., Karlen,M., Sulniute,R., Ericson,J.,
            Andersson,E. and Ahlgren,U.
  TITLE     Cloning and analysis of Nkx6.3 during CNS and gastrointestinal
            development
  JOURNAL   Gene Expr. Patterns 6 (2), 162-170 (2006)
   PUBMED   16326147
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AK057898.1.
            On Apr 1, 2006 this sequence version replaced gi:22749178.
            
            Summary: The NKX family of homeodomain proteins controls numerous
            developmental processes. Members of the NKX6 subfamily, including
            NKX6-3, are involved in development of the central nervous system
            (CNS), gastrointestinal tract, and pancreas (Alanentalo et al.,
            2006 [PubMed 16326147]).[supplied by OMIM, Mar 2008].
            
            ##Evidence-Data-START##
            CDS exon combination :: AK057898.1 [ECO:0000331]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-551               AK057898.1         1-551
FEATURES             Location/Qualifiers
     source          1..551
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="8"
                     /map="8p11.21"
     gene            1..551
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /note="NK6 homeobox 3"
                     /db_xref="GeneID:157848"
                     /db_xref="HGNC:26328"
                     /db_xref="HPRD:08053"
                     /db_xref="MIM:610772"
     exon            1..166
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /inference="alignment:Splign:1.39.8"
     CDS             5..412
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /note="NK6 transcription factor related, locus 3"
                     /codon_start=1
                     /product="homeobox protein Nkx-6.3"
                     /protein_id="NP_689781.1"
                     /db_xref="GI:22749179"
                     /db_xref="CCDS:CCDS6118.1"
                     /db_xref="GeneID:157848"
                     /db_xref="HGNC:26328"
                     /db_xref="HPRD:08053"
                     /db_xref="MIM:610772"
                     /translation="
MQQGQLAPGSRLCSGPWGLPELQPAAPSSSAAQLPWGESWGEEADTPACLSASGVWFQNRRTKWRKKSALEPSSSTPRAPGGAGAGAGGDRAPSENEDDEYNKPLDPDSDDEKIRLLLRKHRAAFSVLSLGAHSV
"
     misc_feature    <167..202
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cl00084"
                     /db_xref="CDD:206827"
     variation       complement(47)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185748313"
     variation       complement(77)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:114744615"
     variation       complement(98)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143818219"
     variation       complement(107)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:35477742"
     exon            167..551
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(202)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201587344"
     variation       complement(237)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376394761"
     variation       complement(259)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200284600"
     variation       complement(275)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139901321"
     variation       complement(301)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144689508"
     variation       complement(308)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368688373"
     variation       complement(326)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:149367780"
     variation       complement(337)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202195558"
     variation       complement(368)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138815732"
     variation       complement(373)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200127895"
     variation       complement(379)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200542322"
     variation       complement(382)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:150233546"
     variation       complement(443)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:58895504"
     variation       complement(457..458)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:144242085"
     variation       complement(522..525)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace=""
                     /replace="tctt"
                     /db_xref="dbSNP:3063733"
     variation       complement(523..526)
                     /gene="NKX6-3"
                     /gene_synonym="NKX6.3"
                     /replace=""
                     /replace="cttt"
                     /db_xref="dbSNP:5891165"
ORIGIN      
aaggatgcagcaggggcagctggcacctgggtctaggctttgctcagggccctggggcctccccgagctccaacccgctgcgccctcctcatcagccgctcagctgccctggggcgagagctggggggaagaagcagacactcctgcatgtctttctgcttctggggtgtggttccagaaccgcaggaccaagtggcggaagaagagcgccctggagccctcgtcctccacgccccgggccccgggcggcgcgggtgcaggcgcaggcggggaccgcgcaccctcggagaacgaggacgacgagtacaacaagccgctggaccccgactcggacgacgagaagatccgcctgctgctgcgcaagcaccgcgccgccttctcggtgctcagcctgggagcgcacagcgtctgacgcccgccgtccaggcccgggatcctggctgcagcctgcggggggacgccgaggagcctaccttcccctccccttccccacgctcctgggggcgcagggactgagtctttctttggatgaggggcgcgtggaggaggag
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:157848 -> Molecular function: GO:0000976 [transcription regulatory region sequence-specific DNA binding] evidence: IEA
            GeneID:157848 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:157848 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
            GeneID:157848 -> Cellular component: GO:0005634 [nucleus] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.