Home |
Help |
Advanced search
2025-05-09 20:25:44, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_152568 551 bp mRNA linear PRI 12-APR-2013 DEFINITION Homo sapiens NK6 homeobox 3 (NKX6-3), mRNA. ACCESSION NM_152568 VERSION NM_152568.2 GI:90962997 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 551) AUTHORS Alanentalo,T., Chatonnet,F., Karlen,M., Sulniute,R., Ericson,J., Andersson,E. and Ahlgren,U. TITLE Cloning and analysis of Nkx6.3 during CNS and gastrointestinal development JOURNAL Gene Expr. Patterns 6 (2), 162-170 (2006) PUBMED 16326147 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AK057898.1. On Apr 1, 2006 this sequence version replaced gi:22749178. Summary: The NKX family of homeodomain proteins controls numerous developmental processes. Members of the NKX6 subfamily, including NKX6-3, are involved in development of the central nervous system (CNS), gastrointestinal tract, and pancreas (Alanentalo et al., 2006 [PubMed 16326147]).[supplied by OMIM, Mar 2008]. ##Evidence-Data-START## CDS exon combination :: AK057898.1 [ECO:0000331] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-551 AK057898.1 1-551 FEATURES Location/Qualifiers source 1..551 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="8" /map="8p11.21" gene 1..551 /gene="NKX6-3" /gene_synonym="NKX6.3" /note="NK6 homeobox 3" /db_xref="GeneID:157848" /db_xref="HGNC:26328" /db_xref="HPRD:08053" /db_xref="MIM:610772" exon 1..166 /gene="NKX6-3" /gene_synonym="NKX6.3" /inference="alignment:Splign:1.39.8" CDS 5..412 /gene="NKX6-3" /gene_synonym="NKX6.3" /note="NK6 transcription factor related, locus 3" /codon_start=1 /product="homeobox protein Nkx-6.3" /protein_id="NP_689781.1" /db_xref="GI:22749179" /db_xref="CCDS:CCDS6118.1" /db_xref="GeneID:157848" /db_xref="HGNC:26328" /db_xref="HPRD:08053" /db_xref="MIM:610772" /translation="
MQQGQLAPGSRLCSGPWGLPELQPAAPSSSAAQLPWGESWGEEADTPACLSASGVWFQNRRTKWRKKSALEPSSSTPRAPGGAGAGAGGDRAPSENEDDEYNKPLDPDSDDEKIRLLLRKHRAAFSVLSLGAHSV
"
misc_feature <167..202
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/note="Homeodomain; DNA binding domains involved in the
transcriptional regulation of key eukaryotic developmental
processes; may bind to DNA as monomers or as homo- and/or
heterodimers, in a sequence-specific manner; Region:
homeodomain; cl00084"
/db_xref="CDD:206827"
variation complement(47)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace="a"
/replace="g"
/db_xref="dbSNP:185748313"
variation complement(77)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace="g"
/replace="t"
/db_xref="dbSNP:114744615"
variation complement(98)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace="a"
/replace="g"
/db_xref="dbSNP:143818219"
variation complement(107)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace=""
/replace="c"
/db_xref="dbSNP:35477742"
exon 167..551
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/inference="alignment:Splign:1.39.8"
variation complement(202)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace="a"
/replace="g"
/db_xref="dbSNP:201587344"
variation complement(237)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace="a"
/replace="g"
/db_xref="dbSNP:376394761"
variation complement(259)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace="a"
/replace="g"
/db_xref="dbSNP:200284600"
variation complement(275)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace="c"
/replace="t"
/db_xref="dbSNP:139901321"
variation complement(301)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace="c"
/replace="t"
/db_xref="dbSNP:144689508"
variation complement(308)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace="a"
/replace="g"
/db_xref="dbSNP:368688373"
variation complement(326)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace="g"
/replace="t"
/db_xref="dbSNP:149367780"
variation complement(337)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace="c"
/replace="t"
/db_xref="dbSNP:202195558"
variation complement(368)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace="c"
/replace="t"
/db_xref="dbSNP:138815732"
variation complement(373)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace="c"
/replace="t"
/db_xref="dbSNP:200127895"
variation complement(379)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace="c"
/replace="t"
/db_xref="dbSNP:200542322"
variation complement(382)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace="c"
/replace="g"
/db_xref="dbSNP:150233546"
variation complement(443)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace="g"
/replace="t"
/db_xref="dbSNP:58895504"
variation complement(457..458)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace=""
/replace="g"
/db_xref="dbSNP:144242085"
variation complement(522..525)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace=""
/replace="tctt"
/db_xref="dbSNP:3063733"
variation complement(523..526)
/gene="NKX6-3"
/gene_synonym="NKX6.3"
/replace=""
/replace="cttt"
/db_xref="dbSNP:5891165"
ORIGIN
aaggatgcagcaggggcagctggcacctgggtctaggctttgctcagggccctggggcctccccgagctccaacccgctgcgccctcctcatcagccgctcagctgccctggggcgagagctggggggaagaagcagacactcctgcatgtctttctgcttctggggtgtggttccagaaccgcaggaccaagtggcggaagaagagcgccctggagccctcgtcctccacgccccgggccccgggcggcgcgggtgcaggcgcaggcggggaccgcgcaccctcggagaacgaggacgacgagtacaacaagccgctggaccccgactcggacgacgagaagatccgcctgctgctgcgcaagcaccgcgccgccttctcggtgctcagcctgggagcgcacagcgtctgacgcccgccgtccaggcccgggatcctggctgcagcctgcggggggacgccgaggagcctaccttcccctccccttccccacgctcctgggggcgcagggactgagtctttctttggatgaggggcgcgtggaggaggag
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:157848 -> Molecular function: GO:0000976 [transcription regulatory region sequence-specific DNA binding] evidence: IEA
GeneID:157848 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
GeneID:157848 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
GeneID:157848 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.