LOCUS       NM_032495               1552 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens HOP homeobox (HOPX), transcript variant 1, mRNA.
ACCESSION   NM_032495
VERSION     NM_032495.5  GI:224282186
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1552)
  AUTHORS   Willmer,T., Contu,L., Blatch,G.L. and Edkins,A.L.
  TITLE     Knockdown of Hop downregulates RhoC expression, and decreases
            pseudopodia formation and migration in cancer cell lines
  JOURNAL   Cancer Lett. 328 (2), 252-260 (2013)
   PUBMED   23036489
  REMARK    GeneRIF: Knockdown of Hop caused a decrease in the level of RhoC
            GTPase, and significantly inhibited pseudopodia formation in Hs578T
            cells. Our data suggest that Hop regulates directional cell
            migration by multiple unknown mechanisms.
REFERENCE   2  (bases 1 to 1552)
  AUTHORS   Katoh,H., Yamashita,K., Waraya,M., Margalit,O., Ooki,A., Tamaki,H.,
            Sakagami,H., Kokubo,K., Sidransky,D. and Watanabe,M.
  TITLE     Epigenetic silencing of HOPX promotes cancer progression in
            colorectal cancer
  JOURNAL   Neoplasia 14 (7), 559-571 (2012)
   PUBMED   22904674
  REMARK    GeneRIF: HOPX-beta promoter methylation is a frequent and
            cancer-specific event in CRC progression.
REFERENCE   3  (bases 1 to 1552)
  AUTHORS   Southworth,D.R. and Agard,D.A.
  TITLE     Client-loading conformation of the Hsp90 molecular chaperone
            revealed in the cryo-EM structure of the human Hsp90:Hop complex
  JOURNAL   Mol. Cell 42 (6), 771-781 (2011)
   PUBMED   21700222
  REMARK    GeneRIF: results identify distinct functions for the Hop
            cochaperone, revealing an asymmetric mechanism for Hsp90 regulation
            and client loading
REFERENCE   4  (bases 1 to 1552)
  AUTHORS   Trivedi,C.M., Cappola,T.P., Margulies,K.B. and Epstein,J.A.
  TITLE     Homeodomain only protein x is down-regulated in human heart failure
  JOURNAL   J. Mol. Cell. Cardiol. 50 (6), 1056-1058 (2011)
   PUBMED   21382376
  REMARK    GeneRIF: HOPX/Hopx expression is reduced in multiple examples of
            human and murine cardiac hypertrophy and failure.
REFERENCE   5  (bases 1 to 1552)
  AUTHORS   Obarzanek-Fojt,M., Favre,B., Kypriotou,M., Ryser,S., Huber,M. and
            Hohl,D.
  TITLE     Homeodomain-only protein HOP is a novel modulator of late
            differentiation in keratinocytes
  JOURNAL   Eur. J. Cell Biol. 90 (4), 279-290 (2011)
   PUBMED   21256618
  REMARK    GeneRIF: HOP is a novel modulator of late terminal differentiation
            in keratinocytes
REFERENCE   6  (bases 1 to 1552)
  AUTHORS   Kook,H. and Epstein,J.A.
  TITLE     Hopping to the beat. Hop regulation of cardiac gene expression
  JOURNAL   Trends Cardiovasc. Med. 13 (7), 261-264 (2003)
   PUBMED   14522464
  REMARK    GeneRIF: One role of Hop is to modify the expression of
            cardiac-specific genes and thereby finely regulate heart
            development.
            Review article
REFERENCE   7  (bases 1 to 1552)
  AUTHORS   Kook,H., Lepore,J.J., Gitler,A.D., Lu,M.M., Wing-Man Yung,W.,
            Mackay,J., Zhou,R., Ferrari,V., Gruber,P. and Epstein,J.A.
  TITLE     Cardiac hypertrophy and histone deacetylase-dependent
            transcriptional repression mediated by the atypical homeodomain
            protein Hop
  JOURNAL   J. Clin. Invest. 112 (6), 863-871 (2003)
   PUBMED   12975471
REFERENCE   8  (bases 1 to 1552)
  AUTHORS   Asanoma,K., Matsuda,T., Kondo,H., Kato,K., Kishino,T., Niikawa,N.,
            Wake,N. and Kato,H.
  TITLE     NECC1, a candidate choriocarcinoma suppressor gene that encodes a
            homeodomain consensus motif
  JOURNAL   Genomics 81 (1), 15-25 (2003)
   PUBMED   12573257
  REMARK    GeneRIF: Loss of NECC1 expression is involved in malignant
            conversion of placental trophoblasts.
REFERENCE   9  (bases 1 to 1552)
  AUTHORS   Chen,Y., Petersen,S., Pacyna-Gengelbach,M., Pietas,A. and
            Petersen,I.
  TITLE     Identification of a novel homeobox-containing gene, LAGY, which is
            downregulated in lung cancer
  JOURNAL   Oncology 64 (4), 450-458 (2003)
   PUBMED   12759545
  REMARK    GeneRIF: Gene mapping locates LAGY on chromosome 4q11-13.1. In 72
            primary lung tumors, this gene was significantly down-regulated
            compared to 9 normal lung tissue samples.
REFERENCE   10 (bases 1 to 1552)
  AUTHORS   Adu,J., Leong,F.T., Smith,N.R., Leek,J.P., Markham,A.F.,
            Robinson,P.A. and Mighell,A.J.
  TITLE     Expression of mOb1, a novel atypical 73 amino acid K50-homeodomain
            protein, during mouse development
  JOURNAL   Mech. Dev. 119 (SUPPL 1), S43-S47 (2002)
   PUBMED   14516659
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DA512059.1, AB059408.1 and
            AA504137.1.
            On Feb 27, 2009 this sequence version replaced gi:47717119.
            
            Summary: The protein encoded by this gene is a homeodomain protein
            that lacks certain conserved residues required for DNA binding. It
            was reported that choriocarcinoma cell lines and tissues failed to
            express this gene, which suggested the possible involvement of this
            gene in malignant conversion of placental trophoblasts. Studies in
            mice suggest that this protein may interact with serum response
            factor (SRF) and modulate SRF-dependent cardiac-specific gene
            expression and cardiac development. Multiple alternatively spliced
            transcript variants have been identified for this gene. [provided
            by RefSeq, Feb 2009].
            
            Transcript Variant: This variant (1) encodes isoform a.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            CDS exon combination :: H48308.1 [ECO:0000331]
            RNAseq introns       :: single sample supports all introns
                                    ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-452               DA512059.1         1-452
            453-1533            AB059408.1         13-1093
            1534-1552           AA504137.1         1-19                c
FEATURES             Location/Qualifiers
     source          1..1552
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="4"
                     /map="4q12"
     gene            1..1552
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /note="HOP homeobox"
                     /db_xref="GeneID:84525"
                     /db_xref="HGNC:24961"
                     /db_xref="MIM:607275"
     exon            1..452
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /inference="alignment:Splign:1.39.8"
     variation       71
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:28362615"
     exon            453..577
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    485..487
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /note="upstream in-frame stop codon"
     CDS             536..811
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /note="isoform a is encoded by transcript variant 1; not
                     expressed in choriocarcinoma clone 1; lung
                     cancer-associated Y protein; odd homeobox 1 protein;
                     homeodomain-only protein; odd homeobox protein 1; not
                     expressed in choriocarcinoma protein 1"
                     /codon_start=1
                     /product="homeodomain-only protein isoform a"
                     /protein_id="NP_115884.4"
                     /db_xref="GI:224282187"
                     /db_xref="CCDS:CCDS47062.1"
                     /db_xref="GeneID:84525"
                     /db_xref="HGNC:24961"
                     /db_xref="MIM:607275"
                     /translation="

MLIFLGCYRRRLEERAGTMSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD

"
     misc_feature    617..775
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(668..670,686..688,725..727,731..736,743..748,
                     752..760,764..769)
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(734..736,743..748,755..757)
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     exon            578..733
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /inference="alignment:Splign:1.39.8"
     variation       604
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:11555051"
     variation       622
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11555052"
     exon            734..1543
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /inference="alignment:Splign:1.39.8"
     variation       850
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11555050"
     STS             1242..1342
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /standard_name="A006J04"
                     /db_xref="UniSTS:23337"
     STS             1242..1342
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /standard_name="G32360"
                     /db_xref="UniSTS:116951"
     STS             1253..1501
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /standard_name="D4S2787"
                     /db_xref="UniSTS:65720"
     STS             1273..1372
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /standard_name="D4S2900"
                     /db_xref="UniSTS:79088"
     STS             1285..1484
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /standard_name="A006D37"
                     /db_xref="UniSTS:13043"
     STS             1285..1484
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /standard_name="G20731"
                     /db_xref="UniSTS:13044"
     variation       1414
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3184677"
     polyA_signal    1509..1514
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
     polyA_site      1533
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
     polyA_site      1543
                     /gene="HOPX"
                     /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
                     TOTO"
ORIGIN      

gcaccagatctacgctttgaaatgaggcaacatctaactggaaactcgctcaaagtaaggaagtggatgagaagactcagggtcccttttctcttccccgtcttctctcagccacatctctcttatcctatcttggtgaagaagcttgcttggctaggagagaggtcagggacgagaagatagtgacgagaaagttccatgagactctcagaagtcccagcctgaacatcaaacctgaataaccaggagagacgtaacctcggcatactttcagtggtttacctcctgcccacgctgcaggtttttcaggtccttgctcgagtgtgtgctcataggcgtaaataaacgtgctatcagcagcctgcgtcagccagcccagctatttaagcaggctggcatcagcaaacacagcttccaaacccagggcttgcgcttgcctttgcctcttccacactaatgacagactgccccactgagaagggtctagcggagcacaggtcaccagctgggcaacattcagaaagttagtcttcctatgctcattttcctgggctgttacagaagaagactggaagagcgcgcagggaccatgtcggcggagaccgcgagcggccccacagaggaccaggtggaaatcctggagtacaacttcaacaaggtcgacaagcacccggattccaccacgctgtgcctcatcgcggccgaggcaggcctttccgaggaggagacccagaaatggtttaagcagcgcctggcaaagtggcggcgctcagaaggcctgccctcagagtgcagatccgtcacagactaaggagatggcaggcattgacagcttcactccatgaaggccatctctgtttctctcctccgcttaaccaagctgttgtggtttttcagcatagtgttgtatgttccattgctagctgtcctgctgtttaacacagtgttgtattttttttctaaatgtacataattagaaaagaaaataacaataggaagctatgtgtatcttctgtgtaaagcagtggcttcactggaaaaatggtgtggctagcatttccctttgagtcatgatgacagatggtgtgaaaaccatctaagtttgcttttgaccatcacctcccagtagcaatttgctttcataatccatttagcaatccaggcctctgttgaaaagataatatgagggagaagggaacacatttccttctgaacttacttccctaagtcactttccttatgtatcatctaatacaatgatggttgagtgaaaatacagaaggggtgtttgagtattcagatttcataaaacacttccttggaatatagctgcattaacttggaaagaagcctgttgggccagaagacagaaactccaactggcaaaaaagcaagcatctaagaaaaaaaaccaccaaagttcttgaatttactatatttaaatgcattggttaagtttattttgctaaataaagtgaactgctttttgtctctaaaatgatattctaaataaaaccttaactttttgttgaagatgcactgaaaaaaaaaa

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:84525 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:84525 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:84525 -> Biological process: GO:0001829 [trophectodermal cell differentiation] evidence: IDA
            GeneID:84525 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
            GeneID:84525 -> Biological process: GO:0045596 [negative regulation of cell differentiation] evidence: IDA
            GeneID:84525 -> Cellular component: GO:0005634 [nucleus] evidence: IDA