GGRNA Home | Help | Advanced search

2025-05-09 20:22:18, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_024865               2098 bp    mRNA    linear   PRI 16-JUN-2013
DEFINITION  Homo sapiens Nanog homeobox (NANOG), mRNA.
ACCESSION   NM_024865
VERSION     NM_024865.2  GI:153945815
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2098)
  AUTHORS   Wang,Y., Xu,Z., Jiang,J., Xu,C., Kang,J., Xiao,L., Wu,M., Xiong,J.,
            Guo,X. and Liu,H.
  TITLE     Endogenous miRNA sponge lincRNA-RoR regulates Oct4, Nanog, and Sox2
            in human embryonic stem cell self-renewal
  JOURNAL   Dev. Cell 25 (1), 69-80 (2013)
   PUBMED   23541921
  REMARK    GeneRIF: Linc-RoR (long intergenic non-protein coding RNA regulator
            of reprogramming) regulates endogenous Oct4, Nanog, and Sox2
            expression in self-renewing and differentiating human embryonic
            stem cells.
REFERENCE   2  (bases 1 to 2098)
  AUTHORS   Amsterdam,A., Raanan,C., Schreiber,L., Polin,N. and Givol,D.
  TITLE     LGR5 and Nanog identify stem cell signature of pancreas beta cells
            which initiate pancreatic cancer
  JOURNAL   Biochem. Biophys. Res. Commun. 433 (2), 157-162 (2013)
   PUBMED   23438436
  REMARK    GeneRIF: the islet's beta cells, expressing LGR5 and Nanog markers
            are the initiating cells of pancreas cancer and Nanog is a major
            biomarker for pancreatic ductal adenocarcinomas
REFERENCE   3  (bases 1 to 2098)
  AUTHORS   Li,Y., Higashiyama,S., Shimakage,M., Kawahara,K., Yutsudo,M. and
            Watari,A.
  TITLE     Involvement of NANOG upregulation in malignant progression of human
            cells
  JOURNAL   DNA Cell Biol. 32 (3), 104-110 (2013)
   PUBMED   23427894
  REMARK    GeneRIF: NANOG was upregulated during malignant progression.
REFERENCE   4  (bases 1 to 2098)
  AUTHORS   Wu,J. and Tzanakakis,E.S.
  TITLE     Contribution of stochastic partitioning at human embryonic stem
            cell division to NANOG heterogeneity
  JOURNAL   PLoS ONE 7 (11), E50715 (2012)
   PUBMED   23226362
  REMARK    GeneRIF: role of NANOG heterogeneity in human embryonic stem cell
            division
REFERENCE   5  (bases 1 to 2098)
  AUTHORS   Yang,L., Zhang,X., Zhang,M., Zhang,J., Sheng,Y., Sun,X., Chen,Q.
            and Wang,L.X.
  TITLE     Increased Nanog expression promotes tumor development and Cisplatin
            resistance in human esophageal cancer cells
  JOURNAL   Cell. Physiol. Biochem. 30 (4), 943-952 (2012)
   PUBMED   23221432
  REMARK    GeneRIF: The sensitivity of cisplatin was decreased with increased
            expression of Nanog. Nanog expression could promote the
            proliferation and invasiveness of the cancer cells, and inhibit the
            apoptosis.
REFERENCE   6  (bases 1 to 2098)
  AUTHORS   Clark,A.T., Rodriguez,R.T., Bodnar,M.S., Abeyta,M.J., Cedars,M.I.,
            Turek,P.J., Firpo,M.T. and Reijo Pera,R.A.
  TITLE     Human STELLAR, NANOG, and GDF3 genes are expressed in pluripotent
            cells and map to chromosome 12p13, a hotspot for teratocarcinoma
  JOURNAL   Stem Cells 22 (2), 169-179 (2004)
   PUBMED   14990856
REFERENCE   7  (bases 1 to 2098)
  AUTHORS   Chambers,I., Colby,D., Robertson,M., Nichols,J., Lee,S., Tweedie,S.
            and Smith,A.
  TITLE     Functional expression cloning of Nanog, a pluripotency sustaining
            factor in embryonic stem cells
  JOURNAL   Cell 113 (5), 643-655 (2003)
   PUBMED   12787505
REFERENCE   8  (bases 1 to 2098)
  AUTHORS   Mitsui,K., Tokuzawa,Y., Itoh,H., Segawa,K., Murakami,M.,
            Takahashi,K., Maruyama,M., Maeda,M. and Yamanaka,S.
  TITLE     The homeoprotein Nanog is required for maintenance of pluripotency
            in mouse epiblast and ES cells
  JOURNAL   Cell 113 (5), 631-642 (2003)
   PUBMED   12787504
REFERENCE   9  (bases 1 to 2098)
  AUTHORS   Cavaleri,F. and Scholer,H.R.
  TITLE     Nanog: a new recruit to the embryonic stem cell orchestra
  JOURNAL   Cell 113 (5), 551-552 (2003)
   PUBMED   12787492
  REMARK    Review article
REFERENCE   10 (bases 1 to 2098)
  AUTHORS   Constantinescu,S.
  TITLE     Stemness, fusion and renewal of hematopoietic and embryonic stem
            cells
  JOURNAL   J. Cell. Mol. Med. 7 (2), 103-112 (2003)
   PUBMED   12927049
  REMARK    Review article
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC006517.46.
            On Jul 26, 2007 this sequence version replaced gi:13376297.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AB093576.1, BC069807.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025098 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-367               AC006517.46        75962-76328         c
            368-630             AC006517.46        72515-72777         c
            631-717             AC006517.46        71184-71270         c
            718-2098            AC006517.46        69668-71048         c
FEATURES             Location/Qualifiers
     source          1..2098
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="12"
                     /map="12p13.31"
     gene            1..2098
                     /gene="NANOG"
                     /note="Nanog homeobox"
                     /db_xref="GeneID:79923"
                     /db_xref="HGNC:20857"
                     /db_xref="MIM:607937"
     exon            1..367
                     /gene="NANOG"
                     /inference="alignment:Splign:1.39.8"
     variation       40
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150329406"
     variation       58
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:137856893"
     STS             69..1301
                     /gene="NANOG"
                     /db_xref="UniSTS:484047"
     misc_feature    97..99
                     /gene="NANOG"
                     /note="upstream in-frame stop codon"
     variation       132
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149459976"
     variation       168
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375185896"
     variation       173
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201306414"
     variation       196
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369467702"
     CDS             217..1134
                     /gene="NANOG"
                     /note="homeobox transcription factor Nanog; homeobox
                     transcription factor Nanog-delta 48; hNanog"
                     /codon_start=1
                     /product="homeobox protein NANOG"
                     /protein_id="NP_079141.2"
                     /db_xref="GI:153945816"
                     /db_xref="CCDS:CCDS31736.1"
                     /db_xref="GeneID:79923"
                     /db_xref="HGNC:20857"
                     /db_xref="MIM:607937"
                     /translation="
MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV
"
     misc_feature    508..678
                     /gene="NANOG"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(508..516,520..522,571..573,589..591,628..630,
                     634..639,646..651,655..663,667..672)
                     /gene="NANOG"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(508..510,517..519,637..639,646..651,658..660)
                     /gene="NANOG"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     misc_feature    802..936
                     /gene="NANOG"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9H9S0.2);
                     Region: 8 X repeats starting with a Trp in each unit"
     misc_feature    802..936
                     /gene="NANOG"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9H9S0.2);
                     Region: Sufficient for transactivation activity (By
                     similarity)"
     misc_feature    937..1131
                     /gene="NANOG"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9H9S0.2);
                     Region: Sufficient for strong transactivation activity (By
                     similarity)"
     variation       221
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:142192505"
     variation       223
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373057005"
     variation       263
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2889552"
     variation       267
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:377465904"
     variation       275
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142142006"
     variation       282
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144872761"
     variation       290
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138784058"
     variation       331
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:140243232"
     variation       351
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371254743"
     variation       355
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:112366619"
     variation       360
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2377097"
     exon            368..630
                     /gene="NANOG"
                     /inference="alignment:Splign:1.39.8"
     variation       374
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:71445169"
     variation       381
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4294629"
     variation       413
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201427723"
     variation       428
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199844601"
     variation       462
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2889551"
     variation       486
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367909941"
     variation       492
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4354764"
     variation       503
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:375983497"
     variation       531
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145906125"
     variation       569
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370774570"
     variation       579
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4438116"
     variation       586
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373700728"
     exon            631..717
                     /gene="NANOG"
                     /inference="alignment:Splign:1.39.8"
     variation       693
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142963939"
     exon            718..2098
                     /gene="NANOG"
                     /inference="alignment:Splign:1.39.8"
     variation       744
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:148350742"
     variation       747
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4012939"
     variation       756
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200461817"
     variation       773
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199733579"
     variation       783
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150847430"
     variation       792
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:139890744"
     variation       975
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:4012938"
     variation       1014
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4012937"
     variation       1018
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201280008"
     variation       1113
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199634799"
     variation       1141
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201891299"
     variation       1148
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201553541"
     variation       1152
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199508627"
     variation       1162
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199701391"
     variation       1178
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373028730"
     variation       1317
                     /gene="NANOG"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:371533746"
     variation       1318
                     /gene="NANOG"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:375879008"
     variation       1381
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369573684"
     variation       1422
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376103168"
     STS             1424..1506
                     /gene="NANOG"
                     /standard_name="L18426"
                     /db_xref="UniSTS:34648"
     variation       1448
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2008442"
     variation       1453
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3892960"
     STS             1456..1558
                     /gene="NANOG"
                     /standard_name="D8S2278"
                     /db_xref="UniSTS:473906"
     STS             1464..1553
                     /gene="NANOG"
                     /standard_name="D8S2279"
                     /db_xref="UniSTS:473907"
     variation       1551
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370609162"
     variation       1603
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374312411"
     variation       1631..1632
                     /gene="NANOG"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:71038756"
     variation       1632
                     /gene="NANOG"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:372788492"
     variation       1651
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368729469"
     variation       1688..1689
                     /gene="NANOG"
                     /replace=""
                     /replace="gctaaggacaacattgatagaa"
                     /db_xref="dbSNP:202064081"
     variation       1691..1694
                     /gene="NANOG"
                     /replace=""
                     /replace="taaggacaacattgatagaagc"
                     /db_xref="dbSNP:71038757"
     variation       1702
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183561928"
     variation       1723
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371159545"
     variation       1751
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:189371434"
     variation       1780
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150094002"
     variation       1888..1889
                     /gene="NANOG"
                     /replace=""
                     /replace="ggc"
                     /db_xref="dbSNP:201124730"
     variation       1891..1892
                     /gene="NANOG"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:200881551"
     variation       1892
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148073342"
     variation       1919
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35472045"
     variation       1956
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182372778"
     variation       1960
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:34237790"
     variation       1992
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34367740"
     variation       2024
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:367992868"
     variation       2027
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:35212015"
     variation       2073
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34956956"
ORIGIN      
attataaatctagagactccaggattttaacgttctgctggactgagctggttgcctcatgttattatgcaggcaactcactttatcccaatttcttgatacttttccttctggaggtcctatttctctaacatcttccagaaaagtcttaaagctgccttaaccttttttccagtccacctcttaaattttttcctcctcttcctctatactaacatgagtgtggatccagcttgtccccaaagcttgccttgctttgaagcatccgactgtaaagaatcttcacctatgcctgtgatttgtgggcctgaagaaaactatccatccttgcaaatgtcttctgctgagatgcctcacacggagactgtctctcctcttccttcctccatggatctgcttattcaggacagccctgattcttccaccagtcccaaaggcaaacaacccacttctgcagagaagagtgtcgcaaaaaaggaagacaaggtcccggtcaagaaacagaagaccagaactgtgttctcttccacccagctgtgtgtactcaatgatagatttcagagacagaaatacctcagcctccagcagatgcaagaactctccaacatcctgaacctcagctacaaacaggtgaagacctggttccagaaccagagaatgaaatctaagaggtggcagaaaaacaactggccgaagaatagcaatggtgtgacgcagaaggcctcagcacctacctaccccagcctttactcttcctaccaccagggatgcctggtgaacccgactgggaaccttccaatgtggagcaaccagacctggaacaattcaacctggagcaaccagacccagaacatccagtcctggagcaaccactcctggaacactcagacctggtgcacccaatcctggaacaatcaggcctggaacagtcccttctataactgtggagaggaatctctgcagtcctgcatgcagttccagccaaattctcctgccagtgacttggaggctgccttggaagctgctggggaaggccttaatgtaatacagcagaccactaggtattttagtactccacaaaccatggatttattcctaaactactccatgaacatgcaacctgaagacgtgtgaagatgagtgaaactgatattactcaatttcagtctggacactggctgaatccttcctctcccctcctcccatccctcataggatttttcttgtttggaaaccacgtgttctggtttccatgatgcccatccagtcaatctcatggagggtggagtatggttggagcctaatcagcgaggtttctttttttttttttttcctattggatcttcctggagaaaatactttttttttttttttttttgaaacggagtcttgctctgtcgcccaggctggagtgcagtggcgcggtcttggctcactgcaagctccgtctcccgggttcacgccattctcctgcctcagcctcccgagcagctgggactacaggcgcccgccacctcgcccggctaatattttgtatttttagtagagacggggtttcactgtgttagccaggatggtctcgatctcctgaccttgtgatccacccgcctcggcctccctaacagctgggatttacaggcgtgagccaccgcgccctgcctagaaaagacattttaataaccttggctgccgtctctggctatagataagtagatctaatactagtttggatatctttagggtttagaatctaacctcaagaataagaaatacaagtacaaattggtgatgaagatgtattcgtattgtttgggattgggaggctttgcttattttttaaaaactattgaggtaaagggttaagctgtaacatacttaattgatttcttaccgtttttggctctgttttgctatatcccctaatttgttggttgtgctaatctttgtagaaagaggtctcgtatttgctgcatcgtaatgacatgagtactgctttagttggtttaagttcaaatgaatgaaacaactatttttcctttagttgattttaccctgatttcaccgagtgtttcaatgagtaaatatacagcttaaacat
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:79923 -> Molecular function: GO:0001158 [enhancer sequence-specific DNA binding] evidence: IEA
            GeneID:79923 -> Molecular function: GO:0003677 [DNA binding] evidence: IDA
            GeneID:79923 -> Molecular function: GO:0003682 [chromatin binding] evidence: IEA
            GeneID:79923 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IDA
            GeneID:79923 -> Molecular function: GO:0003714 [transcription corepressor activity] evidence: ISS
            GeneID:79923 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: IEA
            GeneID:79923 -> Biological process: GO:0001710 [mesodermal cell fate commitment] evidence: IEA
            GeneID:79923 -> Biological process: GO:0001714 [endodermal cell fate specification] evidence: IDA
            GeneID:79923 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
            GeneID:79923 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: IDA
            GeneID:79923 -> Biological process: GO:0008283 [cell proliferation] evidence: IMP
            GeneID:79923 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: IEA
            GeneID:79923 -> Biological process: GO:0008406 [gonad development] evidence: IEA
            GeneID:79923 -> Biological process: GO:0009790 [embryo development] evidence: IEP
            GeneID:79923 -> Biological process: GO:0009880 [embryonic pattern specification] evidence: IEA
            GeneID:79923 -> Biological process: GO:0010454 [negative regulation of cell fate commitment] evidence: IEA
            GeneID:79923 -> Biological process: GO:0010468 [regulation of gene expression] evidence: IMP
            GeneID:79923 -> Biological process: GO:0017145 [stem cell division] evidence: IEA
            GeneID:79923 -> Biological process: GO:0030154 [cell differentiation] evidence: IEP
            GeneID:79923 -> Biological process: GO:0030514 [negative regulation of BMP signaling pathway] evidence: IEA
            GeneID:79923 -> Biological process: GO:0032526 [response to retinoic acid] evidence: IEA
            GeneID:79923 -> Biological process: GO:0035019 [somatic stem cell maintenance] evidence: IMP
            GeneID:79923 -> Biological process: GO:0045595 [regulation of cell differentiation] evidence: IMP
            GeneID:79923 -> Biological process: GO:0045931 [positive regulation of mitotic cell cycle] evidence: IEA
            GeneID:79923 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IDA
            GeneID:79923 -> Cellular component: GO:0005634 [nucleus] evidence: IC
            GeneID:79923 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
            GeneID:79923 -> Cellular component: GO:0005654 [nucleoplasm] evidence: IEA
            GeneID:79923 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.