GGRNA Home | Help | Advanced search

2025-05-09 20:36:47, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_024569               4923 bp    mRNA    linear   PRI 14-MAY-2013
DEFINITION  Homo sapiens myelin protein zero-like 1 (MPZL1), transcript variant
            2, mRNA.
ACCESSION   NM_024569
VERSION     NM_024569.4  GI:226054556
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4923)
  AUTHORS   Cummings,A.C., Jiang,L., Velez Edwards,D.R., McCauley,J.L.,
            Laux,R., McFarland,L.L., Fuzzell,D., Knebusch,C., Caywood,L.,
            Reinhart-Mercer,L., Nations,L., Gilbert,J.R., Konidari,I.,
            Tramontana,M., Cuccaro,M.L., Scott,W.K., Pericak-Vance,M.A. and
            Haines,J.L.
  TITLE     Genome-wide association and linkage study in the Amish detects a
            novel candidate late-onset Alzheimer disease gene
  JOURNAL   Ann. Hum. Genet. 76 (5), 342-351 (2012)
   PUBMED   22881374
REFERENCE   2  (bases 1 to 4923)
  AUTHORS   Gallardo,E., Garcia,A., Ramon,C., Maravi,E., Infante,J., Gaston,I.,
            Alonso,A., Combarros,O., De Jonghe,P. and Berciano,J.
  TITLE     Charcot-Marie-Tooth disease type 2J with MPZ Thr124Met mutation:
            clinico-electrophysiological and MRI study of a family
  JOURNAL   J. Neurol. 256 (12), 2061-2071 (2009)
   PUBMED   19629567
  REMARK    GeneRIF: Clinico-electrophysiological features and MRI findings are
            described in leg musculature from three patients belonging to a
            CMT2J pedigree due to MPZ Thr124Met mutation.
REFERENCE   3  (bases 1 to 4923)
  AUTHORS   Ehret,G.B., O'Connor,A.A., Weder,A., Cooper,R.S. and Chakravarti,A.
  TITLE     Follow-up of a major linkage peak on chromosome 1 reveals
            suggestive QTLs associated with essential hypertension: GenNet
            study
  JOURNAL   Eur. J. Hum. Genet. 17 (12), 1650-1657 (2009)
   PUBMED   19536175
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   4  (bases 1 to 4923)
  AUTHORS   Cheung,C.L., Chan,B.Y., Chan,V., Ikegawa,S., Kou,I., Ngai,H.,
            Smith,D., Luk,K.D., Huang,Q.Y., Mori,S., Sham,P.C. and Kung,A.W.
  TITLE     Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible
            genetic association with bone mineral density variation
  JOURNAL   Hum. Mol. Genet. 18 (4), 679-687 (2009)
   PUBMED   19064610
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   5  (bases 1 to 4923)
  AUTHORS   Kusano,K., Thomas,T.N. and Fujiwara,K.
  TITLE     Phosphorylation and localization of protein-zero related (PZR) in
            cultured endothelial cells
  JOURNAL   Endothelium 15 (3), 127-136 (2008)
   PUBMED   18568953
  REMARK    GeneRIF: Phosphorylation and localization of PZR in cultured
            endothelial cells is reported.
REFERENCE   6  (bases 1 to 4923)
  AUTHORS   Wistow,G., Bernstein,S.L., Wyatt,M.K., Fariss,R.N., Behal,A.,
            Touchman,J.W., Bouffard,G., Smith,D. and Peterson,K.
  TITLE     Expressed sequence tag analysis of human RPE/choroid for the
            NEIBank Project: over 6000 non-redundant transcripts, novel genes
            and splice variants
  JOURNAL   Mol. Vis. 8, 205-220 (2002)
   PUBMED   12107410
  REMARK    Publication Status: Online-Only
REFERENCE   7  (bases 1 to 4923)
  AUTHORS   Zhao,R., Guerrah,A., Tang,H. and Zhao,Z.J.
  TITLE     Cell surface glycoprotein PZR is a major mediator of concanavalin
            A-induced cell signaling
  JOURNAL   J. Biol. Chem. 277 (10), 7882-7888 (2002)
   PUBMED   11751924
  REMARK    GeneRIF: PZR is a major receptor of ConA and has an important role
            in cell signaling via c-Src. Considering the various biological
            activities of ConA, the study of PZR may have major therapeutic
            implications
REFERENCE   8  (bases 1 to 4923)
  AUTHORS   Zhao,R. and Zhao,Z.J.
  TITLE     Dissecting the interaction of SHP-2 with PZR, an immunoglobulin
            family protein containing immunoreceptor tyrosine-based inhibitory
            motifs
  JOURNAL   J. Biol. Chem. 275 (8), 5453-5459 (2000)
   PUBMED   10681522
REFERENCE   9  (bases 1 to 4923)
  AUTHORS   Tang,D.S., Yu,K.P., Tang,X.X., Zhang,H.L., Pan,Q., Dai,H.P. and
            Xia,J.H.
  TITLE     Cloning of Human Myelin Protein Zero-like Genes by Bioinformatics
            Strategy
  JOURNAL   Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 32 (4), 364-368 (2000)
   PUBMED   12075424
REFERENCE   10 (bases 1 to 4923)
  AUTHORS   Zhao,Z.J. and Zhao,R.
  TITLE     Purification and cloning of PZR, a binding protein and putative
            physiological substrate of tyrosine phosphatase SHP-2
  JOURNAL   J. Biol. Chem. 273 (45), 29367-29372 (1998)
   PUBMED   9792637
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DA725074.1, AF478447.1, Z99943.1 and AW292498.1.
            On Apr 1, 2009 this sequence version replaced gi:46358425.
            
            Transcript Variant: This variant (2) lacks an alternate coding exon
            compared to variant 1, that causes a frameshift. The resulting
            isoform (b) is shorter and has a distinct C-terminus compared to
            isoform a.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF478447.1, BM473969.1 [ECO:0000332]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-196               DA725074.1         1-196
            197-1090            AF478447.1         155-1048
            1091-4616           Z99943.1           64400-67925
            4617-4923           AW292498.1         1-307               c
FEATURES             Location/Qualifiers
     source          1..4923
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q24.2"
     gene            1..4923
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /note="myelin protein zero-like 1"
                     /db_xref="GeneID:9019"
                     /db_xref="HGNC:7226"
                     /db_xref="MIM:604376"
     exon            1..293
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="alignment:Splign:1.39.8"
     CDS             203..832
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /note="isoform b precursor is encoded by transcript
                     variant 2; protein zero related; myelin protein zero-like
                     protein 1; immunoglobulin family transmembrane protein;
                     protein zero-related"
                     /codon_start=1
                     /product="myelin protein zero-like protein 1 isoform b
                     precursor"
                     /protein_id="NP_078845.3"
                     /db_xref="GI:46358426"
                     /db_xref="CCDS:CCDS44273.1"
                     /db_xref="GeneID:9019"
                     /db_xref="HGNC:7226"
                     /db_xref="MIM:604376"
                     /translation="
MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGAQSYMHS
"
     sig_peptide     203..313
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    317..664
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:213125"
     misc_feature    326..664
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /note="Immunoglobulin V-set domain; Region: V-set;
                     pfam07686"
                     /db_xref="CDD:203725"
     misc_feature    689..751
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95297.1);
                     transmembrane region"
     variation       242
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113319606"
     variation       243
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368926182"
     exon            294..460
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="alignment:Splign:1.39.8"
     variation       319
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200435022"
     variation       338
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369822857"
     variation       372
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375713174"
     variation       397
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150711804"
     variation       404
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146968580"
     variation       415
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143448673"
     variation       418
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201705663"
     variation       450
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369996563"
     exon            461..674
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="alignment:Splign:1.39.8"
     variation       465
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201193049"
     variation       484
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375159380"
     variation       504
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368816230"
     variation       586
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371291585"
     variation       615
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141242973"
     variation       619
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150774030"
     variation       649
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375912956"
     variation       665
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367767112"
     exon            675..807
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="alignment:Splign:1.39.8"
     variation       746
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375340075"
     variation       747
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368992613"
     variation       779
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373029251"
     variation       799
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200583957"
     exon            808..4907
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /inference="alignment:Splign:1.39.8"
     variation       830
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:146099511"
     variation       840
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139028868"
     variation       844
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146869026"
     variation       861..862
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:34626910"
     STS             871..1027
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="SHGC-75878"
                     /db_xref="UniSTS:7599"
     variation       890
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375874838"
     variation       891
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200004895"
     variation       899
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190661858"
     variation       921
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377498586"
     variation       1044
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141592237"
     variation       1080
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150901710"
     variation       1095
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78809449"
     variation       1190
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182898542"
     variation       1191
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185441444"
     variation       1234
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190151302"
     variation       1359
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41270734"
     variation       1493
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182824572"
     STS             1520..1665
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="RH12295"
                     /db_xref="UniSTS:58576"
     variation       1597
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112509046"
     variation       1607
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:187389510"
     variation       1702
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:193160724"
     variation       1708
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138177732"
     variation       1710
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183755663"
     variation       1769
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73037892"
     variation       1774
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:114584283"
     variation       1788
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115952869"
     variation       1811
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:72697779"
     variation       1819
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149549702"
     variation       1831
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370896138"
     variation       1840
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:193135489"
     variation       1849
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147274411"
     variation       1868
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:34678493"
     variation       1945
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140780938"
     variation       2013
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:720612"
     variation       2024
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113574305"
     variation       2054
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147412044"
     variation       2072
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:183563193"
     variation       2087..2088
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:35089441"
     variation       2130
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12072200"
     variation       2177
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:186815046"
     variation       2188
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:7414295"
     variation       2258
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:191636295"
     variation       2271
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184020611"
     variation       2273
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:189800509"
     variation       2293
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182056523"
     variation       2306
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185413057"
     variation       2402
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:10125"
     variation       2414
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142735758"
     variation       2441
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114704696"
     variation       2444..2448
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace=""
                     /replace="aagat"
                     /db_xref="dbSNP:66529257"
     variation       2460
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76940524"
     variation       2474
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35215126"
     STS             2489..3324
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="MPZL1__7200"
                     /db_xref="UniSTS:466339"
     variation       2535
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3752606"
     variation       2591
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151009335"
     variation       2633
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140712114"
     variation       2652
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3088322"
     variation       2747
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143124803"
     variation       2749
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:12745388"
     variation       2884
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74388383"
     variation       2890
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:146700702"
     STS             2914..2988
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="D1S1803E"
                     /db_xref="UniSTS:150719"
     STS             3003..3140
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="WI-12092"
                     /db_xref="UniSTS:34243"
     STS             3004..3103
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="D1S1795E"
                     /db_xref="UniSTS:47740"
     variation       3027
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190565454"
     variation       3032
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:7605"
     STS             3114..3869
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="FLJ21047_2474"
                     /db_xref="UniSTS:463588"
     STS             3164..3265
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="RH36145"
                     /db_xref="UniSTS:64757"
     variation       3170
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11807657"
     variation       3271
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181999887"
     variation       3324
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:14212"
     variation       3355..3358
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace=""
                     /replace="agtt"
                     /db_xref="dbSNP:374021239"
     variation       3402
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61995896"
     variation       3489
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:140274317"
     variation       3502
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:8917"
     variation       3589
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:8623"
     variation       3603
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185284937"
     STS             3613..3726
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /standard_name="A007A43"
                     /db_xref="UniSTS:35948"
     variation       3645
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145325991"
     variation       3653
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12316"
     variation       3916
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12071420"
     variation       3940
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189891170"
     variation       3947
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148979779"
     variation       4060
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:113581119"
     variation       4149
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148155475"
     variation       4176
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141847648"
     variation       4221
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368920044"
     variation       4273
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:10753763"
     variation       4320
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:76775177"
     variation       4357
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:371184482"
     variation       4386
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35065671"
     variation       4442
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:139012766"
     variation       4472
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181105938"
     variation       4482
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:10753764"
     variation       4498
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186660095"
     variation       4551
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191445959"
     variation       4557
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183602418"
     variation       4558
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:10800323"
     variation       4639
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188493549"
     variation       4724
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143146901"
     variation       4821
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192283907"
     variation       4904
                     /gene="MPZL1"
                     /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147481157"
ORIGIN      
agcgagggccggagtggggctgaggcttcggtgcagagctggagagccgcggctgggaccggagtggggagcgcggcgtggaggtgccacccggcgcgggtggcggagagatcagaagcctcttccccaagccgagccaacctcagcggggacccgggctcagggacgcggcggcggcggcggcgactgcagtggctggacgatggcagcgtccgccggagccggggcggtgattgcagccccagacagccggcgctggctgtggtcggtgctggcggcggcgcttgggctcttgacagctggagtatcagccttggaagtatatacgccaaaagaaatcttcgtggcaaatggtacacaagggaagctgacctgcaagttcaagtctactagtacgactggcgggttgacctcagtctcctggagcttccagccagagggggccgacactactgtgtcgtttttccactactcccaagggcaagtgtaccttgggaattatccaccatttaaagacagaatcagctgggctggagaccttgacaagaaagatgcatcaatcaacatagaaaatatgcagtttatacacaatggcacctatatctgtgatgtcaaaaaccctcctgacatcgttgtccagcctggacacattaggctctatgtcgtagaaaaagagaatttgcctgtgtttccagtttgggtagtggtgggcatagttactgctgtggtcctaggtctcactctgctcatcagcatgattctggctgtcctctatagaaggaaaaactctaaacgggattacactggggcccagtcatatatgcacagttagaccactccggcggacatcacagtgacaagattaacaagtcagagtctgtggtgtatgcggatatccgaaagaattaagagaatacctagaacatatcctcagcaagaaacaaaaccaaactggactctcgtgcagaaaatgtagcccattaccacatgtagccttggagacccaggcaaggacaagtacacgtgtactcacagagggagagaaagatgtgtacaaaggatatgtataaatattctatttagtcatcctgatatgaggagccagtgttgcatgatgaaaagatggtatgattctacatatgtacccattgtcttgctgtttttgtactttcttttcaggtcatttacaattgggagatttcagaaacattcctttcaccatcatttagaaatggtttgccttaatggagacaatagcagatcctgtagtatttccagtagacatggccttttaatctaagggcttaagactgattagtcttagcatttactgtagttggaggatggagatgctatgatggaagcatacccagggtggcctttagcacagtatcagtaccatttatttgtctgccgcttttaaaaaatacccattggctatgccacttgaaaacaatttgagaagtttttttgaagtttttctcactaaaatatggggcaattgttagccttacatgttgtgtagacttactttaagtttgcacccttgaaatgtgtcatatcaatttctggattcataatagcaagattagcaaaggataaatgccgaaggtcacttcattctggacacagttggatcaatactgattaagtagaaaatccaagctttgcttgagaacttttgtaacgtggagagtaaaaagtatcggttttattctttgctgatgtcctttctgcttgaaataacagtcaccatacagctaaaggagaggagtttctttccttctaagtaggcagaaatggtatcattatgttgccgctctccaatctcccagagctcgctctctagagaatcaccttctttcgcttttttttttttttttgaggtagagtctcactatgttgcccagactagccttgaactcttgggctcaagtgattctccctcctcagcctcccgagtagctggaacgaactatagttgcaccactgcagctggcaagaatcaccttctttataaagcgtcagtcatgcttccagcaagaggcagcatcagtcatggctttataacagcttcatggtgcctcaaagactgttgaggttaatgagagcctagattagacagtttggctgtccttccctaaaacttgttttctcctattcactactccccaccgcacttaaaatctatgagtttttactttttactgggaatggaaagtgtggtgaagatcattcaacacttatgttgtcatttctcccattttctgaatttttttttaaatttccccccttttaaaattgttcgaaagcccacagttatggaaagaattactgtctagatggtctgcagaacgtgtttggggtgagtgggagtgaggggcaatgttactttttctccctgtagtttggagtccattatgagctgctgctttttcttctcatcttgtcatcttctggggatgtttgaaggctgagttccaacagaattcacaaagggaataaaacaggattgagattttgaggtgtgcacaaggtggtaagataaagggcatatgagcttcaaaactaatgctgttgcatacatgaagccttttgttttttgaggagctatttttgttattcttgtaacgctccaccttacatgccacatctgtgtgagtcaacagggatcaggtttggtcaccacacatgtctgaagctgggcagcgtctgctctgtgttctgtgtggaatggagaaaaaaacgcctgccctgctgccttccatgttcataggcccagcccaagagagtgacacacagtgctggccctgagacatttccacaaagtggtcaactctgccttgcatcctaaaactttttgggcatctattttgaaaactataggagcctttggaaggcctcttatgtttggaggggaagggtgttgagattgtcaccatccttcaagctgagactcctggtgagcctttgccaccatgaaaaccacatagctgaccagggctgtgcttgaggtacagaggacacacattgtagacaggcctgtgtcatgtttccttacagtcgttttttacagagaaaaggggcattgttttttcactgctttctcaacagttcctgtgaataaatgaaacatttcggagctccctgagagcaagagccttcacttcttcttgcggtgccgggaccatgtgttggtgaagctggtgctgtgggggccactcactcgaatgacacctggaggcctgttcctcccttaccactcccttccccagcccgacttcttggcctcctgcccaaccagacacctcaaactctgtcagtgccctggcattctggcagagaatcctcaccagttctcaccaaccttccccccaggcaagggcagctgccagcatggtgctctgccaggacaggtttccctgaaggaagctgctcacactgagatgagcctctcagggcaggacctcttcccaagccctgcacacccacccctgcagcccttttggctccccttttccctgtgcctcagcactcctttcctggttgcagataacgaactaaggttgcctaaagggcagatctgccctctccatgtcttcgtcctggcaaacagggtcgtcttaaaattatgcgctaattctgtatgggagcactcaaaaggcattacttagagattgaaatttcaaactatctctagtttttcaatggaaatatatcagctagggaaaaaccatcaagctcattattattttttgatcttcagttgtatttttgtgaatattttaatacatctttttcaatttctgaattgtgttgtgtgctcattttgaccagaatagaaaaagagatatgcctttcactcatatcattccagctacacctgccttcttttcttcaaaaatgccgtccgtgtgcctgcttctgggcctttgcacatgctgttccctgggcctgaagcatgccttctgccaatattcctgtggtttgctctctgacttcctttaagcctctgctcaaatgttacctcctcagggagaccttctgtgatatataaaagagcaagccccccaccccaccgcctcagccttcctggccccctcagttctgctctagttactctatttctctccctctttcccagtacacacttgtctgttctcccgcattagaacatagttaacaagagaccagaaccttgctgttttgttcactgctccgtctgcagtaaagggaacagcacctggcacttagctgctcaatacatgttacgtggatggatgagtaggtggaagcattcatccattcagcaacctacactgagaacaatcctgtgccaagcactgtgctaagcataaggaaacaaaacaagacaaagctcctcaaggagcttgccacagggtggaggtgacaggtgacatgaatggaagtaactagtagttaccaaatacttggtgtgagccaggcactttgcatttctttctctattatttctgtgagttaacagtaattgtactaatcttaatcccattgtttgaaagattatatggcttacccagggccacttagctaataaaggaacagagaagaggggctgggcctggggccgctgtttgatccacagccttgttcctaaccactatgccctgtggcctctcacaccaaaaggaagtaccaaactgcttccttactcaaataaatgtgctgaaatgcagttgcagttttctcccagtcccttaggagctggttagagagtcccttaggaacttgagagggtagtgtagtctaggtggtaggcacagatgtctgagagctttaacctcagtctggaagacaatgtggtgacttaatttgttgagaactatgttacaaataatgtgttactaataaaacattgaggcttcgcaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:9019 -> Molecular function: GO:0005198 [structural molecule activity] evidence: TAS
            GeneID:9019 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:9019 -> Biological process: GO:0007169 [transmembrane receptor protein tyrosine kinase signaling pathway] evidence: TAS
            GeneID:9019 -> Biological process: GO:0007267 [cell-cell signaling] evidence: TAS
            GeneID:9019 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.