GGRNA | NM_014360.2

LOCUS       NM_014360               1857 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens NK2 homeobox 8 (NKX2-8), mRNA.
ACCESSION   NM_014360
VERSION     NM_014360.2  GI:31377776
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1857)
  AUTHORS   Yu,C., Zhang,Z., Liao,W., Zhao,X., Liu,L., Wu,Y., Liu,Z., Li,Y.,
            Zhong,Y., Chen,K., Li,J., Zhou,F. and Song,L.
  TITLE     The tumor-suppressor gene Nkx2.8 suppresses bladder cancer
            proliferation through upregulation of FOXO3a and inhibition of the
            MEK/ERK signaling pathway
  JOURNAL   Carcinogenesis 33 (3), 678-686 (2012)
   PUBMED   22223847
  REMARK    GeneRIF: overexpression of Nkx2.8 resulted in downregulation of
            p-FOXO3a and inhibition of MEK/ERK pathway activity. silencing
            Nkx2.8 led to upregulation of p-FOXO3a and increase of MEK/ERK
            pathway activity.
REFERENCE   2  (bases 1 to 1857)
  AUTHORS   Harris,T., Pan,Q., Sironi,J., Lutz,D., Tian,J., Sapkar,J.,
            Perez-Soler,R., Keller,S. and Locker,J.
  TITLE     Both gene amplification and allelic loss occur at 14q13.3 in lung
            cancer
  JOURNAL   Clin. Cancer Res. 17 (4), 690-699 (2011)
   PUBMED   21148747
  REMARK    GeneRIF: Most tumors have low expression of Nkx2-8, and its
            expression can inhibit growth of some lung cancer cells.
REFERENCE   3  (bases 1 to 1857)
  AUTHORS   Hsu,D.S., Acharya,C.R., Balakumaran,B.S., Riedel,R.F., Kim,M.K.,
            Stevenson,M., Tuchman,S., Mukherjee,S., Barry,W., Dressman,H.K.,
            Nevins,J.R., Powers,S., Mu,D. and Potti,A.
  TITLE     Characterizing the developmental pathways TTF-1, NKX2-8, and PAX9
            in lung cancer
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 106 (13), 5312-5317 (2009)
   PUBMED   19279207
  REMARK    GeneRIF: Coactivation of the TTF-1 and NKX2-8 pathways identified a
            cluster of lung cancer patients with poor survival and were shown
            to exhibit resistance to cisplatin
            Erratum:[Proc Natl Acad Sci U S A. 2011 Aug 30;108(35):14705]
REFERENCE   4  (bases 1 to 1857)
  AUTHORS   Hamamoto,R., Furukawa,Y., Morita,M., Iimura,Y., Silva,F.P., Li,M.,
            Yagyu,R. and Nakamura,Y.
  TITLE     SMYD3 encodes a histone methyltransferase involved in the
            proliferation of cancer cells
  JOURNAL   Nat. Cell Biol. 6 (8), 731-740 (2004)
   PUBMED   15235609
REFERENCE   5  (bases 1 to 1857)
  AUTHORS   Kajiyama,Y., Tian,J. and Locker,J.
  TITLE     Regulation of alpha-fetoprotein expression by Nkx2.8
  JOURNAL   Mol. Cell. Biol. 22 (17), 6122-6130 (2002)
   PUBMED   12167706
  REMARK    GeneRIF: A murine Nkx2.8 was isolated from the Hepal-6 cell line
            and showed oligonucleotide binding competitive with fetoprotein
            transcription factor.
REFERENCE   6  (bases 1 to 1857)
  AUTHORS   Santagati,F., Gerber,J.K., Blusch,J.H., Kokubu,C., Peters,H.,
            Adamski,J., Werner,T., Balling,R. and Imai,K.
  TITLE     Comparative analysis of the genomic organization of Pax9 and its
            conserved physical association with Nkx2-9 in the human, mouse, and
            pufferfish genomes
  JOURNAL   Mamm. Genome 12 (3), 232-237 (2001)
   PUBMED   11252173
REFERENCE   7  (bases 1 to 1857)
  AUTHORS   Apergis,G.A., Crawford,N., Ghosh,D., Steppan,C.M., Vorachek,W.R.,
            Wen,P. and Locker,J.
  TITLE     A novel nk-2-related transcription factor associated with human
            fetal liver and hepatocellular carcinoma
  JOURNAL   J. Biol. Chem. 273 (5), 2917-2925 (1998)
   PUBMED   9446603
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC041090.1.
            On Jun 4, 2003 this sequence version replaced gi:7657378.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC041090.1, AF000295.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025085 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1857
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="14"
                     /map="14q13.3"
     gene            1..1857
                     /gene="NKX2-8"
                     /gene_synonym="Nkx2-9; NKX2.8; NKX2H"
                     /note="NK2 homeobox 8"
                     /db_xref="GeneID:26257"
                     /db_xref="HGNC:16364"
                     /db_xref="HPRD:04456"
                     /db_xref="MIM:603245"
     exon            1..349
                     /gene="NKX2-8"
                     /gene_synonym="Nkx2-9; NKX2.8; NKX2H"
                     /inference="alignment:Splign:1.39.8"
     CDS             193..912
                     /gene="NKX2-8"
                     /gene_synonym="Nkx2-9; NKX2.8; NKX2H"
                     /note="NK-2 homolog 8; homeobox protein NK-2 homolog H;
                     NK2 transcription factor related, locus 8"
                     /codon_start=1
                     /product="homeobox protein Nkx-2.8"
                     /protein_id="NP_055175.2"
                     /db_xref="GI:31377777"
                     /db_xref="CCDS:CCDS9660.1"
                     /db_xref="GeneID:26257"
                     /db_xref="HGNC:16364"
                     /db_xref="HPRD:04456"
                     /db_xref="MIM:603245"
                     /translation="

MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQRPSARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLKRARAPGAAESPDLAASAELHAAPGLLRRVVVPVLVRDGQPCGGGGGGEVGTAAAQEKCGAPPAAACPLPGYPAFGPGSALGLFPAYQHLASPALVSWNW

"
     misc_feature    445..615
                     /gene="NKX2-8"
                     /gene_synonym="Nkx2-9; NKX2.8; NKX2H"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(445..459,463..465,514..516,532..534,571..573,
                     577..582,589..594,598..606,610..615)
                     /gene="NKX2-8"
                     /gene_synonym="Nkx2-9; NKX2.8; NKX2H"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(451..453,460..462,580..582,589..594,601..603)
                     /gene="NKX2-8"
                     /gene_synonym="Nkx2-9; NKX2.8; NKX2H"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     variation       261
                     /gene="NKX2-8"
                     /gene_synonym="Nkx2-9; NKX2.8; NKX2H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35076464"
     variation       270
                     /gene="NKX2-8"
                     /gene_synonym="Nkx2-9; NKX2.8; NKX2H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2273641"
     exon            350..1803
                     /gene="NKX2-8"
                     /gene_synonym="Nkx2-9; NKX2.8; NKX2H"
                     /inference="alignment:Splign:1.39.8"
ORIGIN

ccggacctcggctttcaaagcggcctgggtgggaagagctgtttatataaacagagattccgctgtaaatgcgctaatatcccggctgccagcgcatggcgagcgcctcccacgcccatccgtaggagcggcgtcccggccgcccctccgttcccagcctgccctgcccccgcctccttcccctcctcggccatggccacctctggacgcctgagcttcaccgtgcgcagccttctagatttacccgagcaggacgcgcaacacctgccgaggcgggagccagaaccacgcgccccccagcccgacccctgcgccgcctggctggattcggagcgcggccactacccttcctcggacgagagcagcctggagaccagcccgccagactcgtcgcagcggccgtccgctaggcccgcgtctccgggctcggacgccgagaaaaggaagaagcggcgggtgctattctccaaggcgcagacgctggagttggagcggcgcttccggcagcagcggtacctgtctgcgcccgagcgcgagcagctggcgagcctgcttcgcctcacgcccacgcaggtcaagatctggttccagaatcatcgctacaagctgaagcgcgctcgcgctccaggggcggcggagtcgcctgacctggcagcatccgccgagctgcacgccgcgcccggcctgctgcgtcgcgtggtggtgccggtgcttgttcgcgacgggcagccgtgcggcggcggcggcggtggcgaggtgggaaccgccgcggcccaggagaagtgcggcgcccctccagccgccgcctgccctctgccgggctaccctgccttcggtcccggctcggcgcttggcctcttccccgcctaccagcacttagcatcccccgccctggtctcctggaactggtgaggccgcagggcggcacctggggctaccctcgactttggagcgcgctctgcgattggagcagggccggagccgaacgcctggaacgctctccgtccgcctccctgcagccccatctccttgggcgccagggtccctggcgcgccctcatcagccgtcgcgcaagcacacacgagggacgtgtgccagagccccctccctcaccttccctccaccgccagccccagagttagattttatgcttgggccttatttgtatatttttaaatagcgatttgtataggaagcaagttatttttttaaaaaatagagtatttttcctcgtagttcgagaataaaatgtgtggggttgggtcccctgcgcgcctgcggggaacgtaggcgggagtcgtgccccccagaccggtgttcgcatcgctggctcgccccttgactggctaagtggggcccggccccagctggatcgaagggcgggttgcagtcccgacacggctttaggaagatacctgggggatggaggggtggtgatgtcagggttgggcgcgggaagaaaaggagaggaggaagctgaggcaactttgggattcttgtcagcgggaggcgtcactggccccagagtgactccgactctccgctgggctcccagagctgctggcgtttcgaataccgaaaagtcaaccctgtggaccacgacagggcagaaggagtttctccggagatgagccggcgaggccaggtgcggggcgcgctgcaccggagcagcccaggccgggccgcaagctgtttccagagtgcaggagccaagtgctcggggaccctttgaaaagtgcctggggacctgaagagcaccggggaatttgtaacccctatttaagcctgcaagtgcctaagttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa

//

Annotations: