LOCUS       NM_006167               3281 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens NK3 homeobox 1 (NKX3-1), transcript variant 1, mRNA.
ACCESSION   NM_006167
VERSION     NM_006167.3  GI:208609997
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3281)
  AUTHORS   Rao,V., Guan,B., Mutton,L.N. and Bieberich,C.J.
  TITLE     Proline-mediated proteasomal degradation of the prostate-specific
            tumor suppressor NKX3.1
  JOURNAL   J. Biol. Chem. 287 (43), 36331-36340 (2012)
   PUBMED   22910912
  REMARK    GeneRIF: Proline-mediated proteasomal degradation of the
            prostate-specific tumor suppressor NKX3.1.
REFERENCE   2  (bases 1 to 3281)
  AUTHORS   Anderson,P.D., McKissic,S.A., Logan,M., Roh,M., Franco,O.E.,
            Wang,J., Doubinskaia,I., van der Meer,R., Hayward,S.W.,
            Eischen,C.M., Eltoum,I.E. and Abdulkadir,S.A.
  TITLE     Nkx3.1 and Myc crossregulate shared target genes in mouse and human
            prostate tumorigenesis
  JOURNAL   J. Clin. Invest. 122 (5), 1907-1919 (2012)
   PUBMED   22484818
  REMARK    GeneRIF: NKX3.1 and MYC coregulate prostate tumorigenesis by
            converging on, and crossregulating, a common set of target genes.
REFERENCE   3  (bases 1 to 3281)
  AUTHORS   Hui,J., Wang,J.Y., Shi,X.H., Zhang,Y.G., Liu,M., Wang,X.,
            Wang,N.N., Chen,X., Liang,S.Y., Wei,D., Zhao,F., Zhang,Y.H. and
            Yang,Z.
  TITLE     [Association of prostate cancer with PDLIM5, SLC22A3 and NKX3-1 in
            Chinese men]
  JOURNAL   Zhonghua Nan Ke Xue 18 (5), 404-411 (2012)
   PUBMED   22741436
  REMARK    GeneRIF: PDLIM5 (rs17021918,T), SLC22A3 (rs9364554,C) and NKX3-1
            (rs1512268,A) SNPs might not be associated with prostate cancer in
            Chinese men.
REFERENCE   4  (bases 1 to 3281)
  AUTHORS   Nagel,S., Ehrentraut,S., Tomasch,J., Lienenklaus,S., Schneider,B.,
            Geffers,R., Meyer,C., Kaufmann,M., Drexler,H.G. and MacLeod,R.A.
  TITLE     Transcriptional activation of prostate specific homeobox gene
            NKX3-1 in subsets of T-cell lymphoblastic leukemia (T-ALL)
  JOURNAL   PLoS ONE 7 (7), E40747 (2012)
   PUBMED   22848398
  REMARK    GeneRIF: Transcriptional activation of prostate specific homeobox
            gene NKX3-1 in subsets of T-cell lymphoblastic leukemia (T-ALL).
REFERENCE   5  (bases 1 to 3281)
  AUTHORS   Korkmaz,K.S., Korkmaz,C.G., Ragnhildstveit,E., Kizildag,S.,
            Pretlow,T.G. and Saatcioglu,F.
  TITLE     Full-length cDNA sequence and genomic organization of human NKX3A -
            alternative forms and regulation by both androgens and estrogens
  JOURNAL   Gene 260 (1-2), 25-36 (2000)
   PUBMED   11137288
REFERENCE   6  (bases 1 to 3281)
  AUTHORS   Carson,J.A., Fillmore,R.A., Schwartz,R.J. and Zimmer,W.E.
  TITLE     The smooth muscle gamma-actin gene promoter is a molecular target
            for the mouse bagpipe homologue, mNkx3-1, and serum response factor
  JOURNAL   J. Biol. Chem. 275 (50), 39061-39072 (2000)
   PUBMED   10993896
REFERENCE   7  (bases 1 to 3281)
  AUTHORS   Choi,C.Y., Kim,Y.H., Kwon,H.J. and Kim,Y.
  TITLE     The homeodomain protein NK-3 recruits Groucho and a histone
            deacetylase complex to repress transcription
  JOURNAL   J. Biol. Chem. 274 (47), 33194-33197 (1999)
   PUBMED   10559189
REFERENCE   8  (bases 1 to 3281)
  AUTHORS   Prescott,J.L., Blok,L. and Tindall,D.J.
  TITLE     Isolation and androgen regulation of the human homeobox cDNA,
            NKX3.1
  JOURNAL   Prostate 35 (1), 71-80 (1998)
   PUBMED   9537602
REFERENCE   9  (bases 1 to 3281)
  AUTHORS   Voeller,H.J., Augustus,M., Madike,V., Bova,G.S., Carter,K.C. and
            Gelmann,E.P.
  TITLE     Coding region of NKX3.1, a prostate-specific homeobox gene on 8p21,
            is not mutated in human prostate cancers
  JOURNAL   Cancer Res. 57 (20), 4455-4459 (1997)
   PUBMED   9377551
  REMARK    Erratum:[Cancer Res 1997 Dec 15;57(24):5613]
REFERENCE   10 (bases 1 to 3281)
  AUTHORS   He,W.W., Sciavolino,P.J., Wing,J., Augustus,M., Hudson,P.,
            Meissner,P.S., Curtis,R.T., Shell,B.K., Bostwick,D.G.,
            Tindall,D.J., Gelmann,E.P., Abate-Shen,C. and Carter,K.C.
  TITLE     A novel human prostate-specific, androgen-regulated homeobox gene
            (NKX3.1) that maps to 8p21, a region frequently deleted in prostate
            cancer
  JOURNAL   Genomics 43 (1), 69-77 (1997)
   PUBMED   9226374
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AF247704.1 and AC051642.5.
            On Oct 4, 2008 this sequence version replaced gi:19923351.
            
            Summary: This gene encodes a homeobox-containing transcription
            factor. This transcription factor functions as a negative regulator
            of epithelial cell growth in prostate tissue. Aberrant expression
            of this gene is associated with prostate tumor progression.
            Alternate splicing results in multiple transcript variants of this
            gene. [provided by RefSeq, Jan 2012].
            
            Transcript Variant: This variant (1) represents the longest
            transcript and encodes the longer isoform (1).
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data because no single transcript was available
            for the full length of the gene. The extent of this transcript is
            supported by transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF247704.1, U80669.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025083, ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-497               AF247704.1         1-497
            498-3281            AC051642.5         236-3019
FEATURES             Location/Qualifiers
     source          1..3281
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="8"
                     /map="8p21.2"
     gene            1..3281
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /note="NK3 homeobox 1"
                     /db_xref="GeneID:4824"
                     /db_xref="HGNC:7838"
                     /db_xref="HPRD:03620"
                     /db_xref="MIM:602041"
     STS             1..803
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /db_xref="UniSTS:481847"
     exon            1..334
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /inference="alignment:Splign:1.39.8"
     STS             17..1553
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /db_xref="UniSTS:486723"
     STS             17..775
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /db_xref="UniSTS:482056"
     CDS             49..753
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /note="isoform 1 is encoded by transcript variant 1; NK
                     homeobox, family 3, A; homeobox protein Nkx-3.1; homeobox
                     protein NK-3 homolog A; NK3 transcription factor homolog
                     A; NK3 transcription factor related, locus 1"
                     /codon_start=1
                     /product="homeobox protein Nkx-3.1 isoform 1"
                     /protein_id="NP_006158.2"
                     /db_xref="GI:19923352"
                     /db_xref="CCDS:CCDS6042.1"
                     /db_xref="GeneID:4824"
                     /db_xref="HGNC:7838"
                     /db_xref="HPRD:03620"
                     /db_xref="MIM:602041"
                     /translation="

MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW

"
     misc_feature    421..597
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(421..435,439..441,490..492,508..510,547..549,
                     553..558,565..570,574..582,586..591)
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(427..429,436..438,556..558,565..570,577..579)
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     variation       202
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2228013"
     exon            335..3281
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /inference="alignment:Splign:1.39.8"
     variation       579
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35350906"
     variation       642
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35675040"
     variation       954
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1567669"
     STS             2616..2778
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /standard_name="RH94244"
                     /db_xref="UniSTS:83723"
     STS             2625..3269
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /standard_name="NKX3-1_1192"
                     /db_xref="UniSTS:277532"
     variation       2926
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /replace=""
                     /replace="a"
                     /replace="aaa"
                     /replace="aaaaaa"
                     /db_xref="dbSNP:3060139"
     STS             2966..3165
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
                     /standard_name="SHGC-57295"
                     /db_xref="UniSTS:75189"
     polyA_signal    3252..3257
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
     polyA_site      3281
                     /gene="NKX3-1"
                     /gene_synonym="BAPX2; NKX3; NKX3.1; NKX3A"
ORIGIN      

gcggtgcgggccgggcgggtgcattcaggccaaggcggggccgccgggatgctcagggttccggagccgcggcccggggaggcgaaagcggagggggccgcgccgccgaccccgtccaagccgctcacgtccttcctcatccaggacatcctgcgggacggcgcgcagcggcaaggcggccgcacgagcagccagagacagcgcgacccggagccggagccagagccagagccagagggaggacgcagccgcgccggggcgcagaacgaccagctgagcaccgggccccgcgccgcgccggaggaggccgagacgctggcagagaccgagccagaaaggcacttggggtcttatctgttggactctgaaaacacttcaggcgcccttccaaggcttccccaaacccctaagcagccgcagaagcgctcccgagctgccttctcccacactcaggtgatcgagttggagaggaagttcagccatcagaagtacctgtcggcccctgaacgggcccacctggccaagaacctcaagctcacggagacccaagtgaagatatggttccagaacagacgctataagactaagcgaaagcagctctcctcggagctgggagacttggagaagcactcctctttgccggccctgaaagaggaggccttctcccgggcctccctggtctccgtgtataacagctatccttactacccatacctgtactgcgtgggcagctggagcccagctttttggtaatgccagctcaggtgacaaccattatgatcaaaaactgccttccccagggtgtctctatgaaaagcacaaggggccaaggtcagggagcaagaggtgtgcacaccaaagctattggagatttgcgtggaaatctcagattcttcactggtgagacaatgaaacaacagagacagtgaaagttttaatacctaagtcattcctccagtgcatactgtaggtcattttttttgcttctggctacctgtttgaaggggagagagggaaaatcaagtggtattttccagcactttgtatgattttggatgagttgtacacccaaggattctgttctgcaactccatcctcctgtgtcactgaatatcaactctgaaagagcaaacctaacaggagaaaggacaaccaggatgaggatgtcaccaactgaattaaacttaagtccagaagcctcctgttggccttggaatatggccaaggctctctctgtccctgtaaaagagaggggcaaatagagagtctccaagagaacgccctcatgctcagcacatatttgcatgggagggggagatgggtgggaggagatgaaaatatcagcttttcttattcctttttattccttttaaaatggtatgccaacttaagtatttacagggtggcccaaatagaacaagatgcactcgctgtgattttaagacaagctgtataaacagaactccactgcaagagggggggccgggccaggagaatctccgcttgtccaagacaggggcctaaggagggtctccacactgctgctaggggctgttgcatttttttattagtagaaagtggaaaggcctcttctcaacttttttcccttgggctggagaatttagaatcagaagtttcctggagttttcaggctatcatatatactgtatcctgaaaggcaacataattcttccttccctccttttaaaattttgtgttcctttttgcagcaattactcactaaagggcttcattttagtccagatttttagtctggctgcacctaacttatgcctcgcttatttagcccgagatctggtctttttttttttttttttttttttttttccgtctccccaaagctttatctgtcttgactttttaaaaaagtttgggggcagattctgaattggctaaaagacatgcatttttaaaactagcaactcttatttctttcctttaaaaatacatagcattaaatcccaaatcctatttaaagacctgacagcttgagaaggtcactactgcatttataggaccttctggtggttctgctgttacgtttgaagtctgacaatccttgagaatctttgcatgcagaggaggtaagaggtattggattttcacagaggaagaacacagcgcagaatgaagggccaggcttactgagctgtccagtggagggctcatgggtgggacatggaaaagaaggcagcctaggccctggggagcccagtccactgagcaagcaagggactgagtgagccttttgcaggaaaaggctaagaaaaaggaaaaccattctaaaacacaacaagaaactgtccaaatgctttgggaactgtgtttattgcctataatgggtccccaaaatgggtaacctagacttcagagagaatgagcagagagcaaaggagaaatctggctgtccttccattttcattctgttatctcaggtgagctggtagaggggagacattagaaaaaaatgaaacaacaaaacaattactaatgaggtacgctgaggcctgggagtctcttgactccactacttaattccgtttagtgagaaacctttcaattttcttttattagaagggccagcttactgttggtggcaaaattgccaacataagttaatagaaagttggccaatttcaccccattttctgtggtttgggctccacattgcaatgttcaatgccacgtgctgctgacaccgaccggagtactagccagcacaaaaggcagggtagcctgaattgctttctgctctttacatttcttttaaaataagcatttagtgctcagtccctactgagtactctttctctcccctcctctgaatttaattctttcaacttgcaatttgcaaggattacacatttcactgtgatgtatattgtgttgcaaaaaaaaaaaaaaagtgtctttgtttaaaattacttggtttgtgaatccatcttgctttttccccattggaactagtcattaacccatctctgaactggtagaaaaacatctgaagagctagtctatcagcatctgacaggtgaattggatggttctcagaaccatttcacccagacagcctgtttctatcctgtttaataaattagtttgggttctctacatgcataacaaaccctgctccaatctgtcacataaaagtctgtgacttgaagtttagtcagcacccccaccaaactttatttttctatgtgttttttgcaacatatgagtgttttgaaaataaagtacccatgtctttattagattta

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:4824 -> Molecular function: GO:0000976 [transcription regulatory region sequence-specific DNA binding] evidence: IDA
            GeneID:4824 -> Molecular function: GO:0000983 [RNA polymerase II core promoter sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:4824 -> Molecular function: GO:0000988 [protein binding transcription factor activity] evidence: IDA
            GeneID:4824 -> Molecular function: GO:0001047 [core promoter binding] evidence: IDA
            GeneID:4824 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IDA
            GeneID:4824 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: NAS
            GeneID:4824 -> Molecular function: GO:0004882 [androgen receptor activity] evidence: IDA
            GeneID:4824 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:4824 -> Molecular function: GO:0008134 [transcription factor binding] evidence: IPI
            GeneID:4824 -> Molecular function: GO:0008656 [cysteine-type endopeptidase activator activity involved in apoptotic process] evidence: IDA
            GeneID:4824 -> Molecular function: GO:0030284 [estrogen receptor activity] evidence: IDA
            GeneID:4824 -> Molecular function: GO:0030295 [protein kinase activator activity] evidence: IDA
            GeneID:4824 -> Molecular function: GO:0030331 [estrogen receptor binding] evidence: IDA
            GeneID:4824 -> Molecular function: GO:0042826 [histone deacetylase binding] evidence: IPI
            GeneID:4824 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IDA
            GeneID:4824 -> Molecular function: GO:0043621 [protein self-association] evidence: IDA
            GeneID:4824 -> Molecular function: GO:0044212 [transcription regulatory region DNA binding] evidence: IDA
            GeneID:4824 -> Molecular function: GO:0097162 [MADS box domain binding] evidence: IEA
            GeneID:4824 -> Biological process: GO:0001656 [metanephros development] evidence: IEA
            GeneID:4824 -> Biological process: GO:0001756 [somitogenesis] evidence: IEA
            GeneID:4824 -> Biological process: GO:0001934 [positive regulation of protein phosphorylation] evidence: IDA
            GeneID:4824 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: NAS
            GeneID:4824 -> Biological process: GO:0006919 [activation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: IDA
            GeneID:4824 -> Biological process: GO:0007275 [multicellular organismal development] evidence: TAS
            GeneID:4824 -> Biological process: GO:0007431 [salivary gland development] evidence: ISS
            GeneID:4824 -> Biological process: GO:0007507 [heart development] evidence: IEA
            GeneID:4824 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: IMP
            GeneID:4824 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IDA
            GeneID:4824 -> Biological process: GO:0008584 [male gonad development] evidence: IEA
            GeneID:4824 -> Biological process: GO:0010628 [positive regulation of gene expression] evidence: IDA
            GeneID:4824 -> Biological process: GO:0010628 [positive regulation of gene expression] evidence: IMP
            GeneID:4824 -> Biological process: GO:0010629 [negative regulation of gene expression] evidence: IDA
            GeneID:4824 -> Biological process: GO:0010942 [positive regulation of cell death] evidence: IDA
            GeneID:4824 -> Biological process: GO:0014068 [positive regulation of phosphatidylinositol 3-kinase cascade] evidence: IDA
            GeneID:4824 -> Biological process: GO:0030521 [androgen receptor signaling pathway] evidence: IDA
            GeneID:4824 -> Biological process: GO:0033574 [response to testosterone stimulus] evidence: ISS
            GeneID:4824 -> Biological process: GO:0035690 [cellular response to drug] evidence: IEP
            GeneID:4824 -> Biological process: GO:0035907 [dorsal aorta development] evidence: IEA
            GeneID:4824 -> Biological process: GO:0043280 [positive regulation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: IDA
            GeneID:4824 -> Biological process: GO:0043491 [protein kinase B signaling cascade] evidence: IMP
            GeneID:4824 -> Biological process: GO:0043569 [negative regulation of insulin-like growth factor receptor signaling pathway] evidence: ISS
            GeneID:4824 -> Biological process: GO:0045860 [positive regulation of protein kinase activity] evidence: IDA
            GeneID:4824 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: IDA
            GeneID:4824 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: IMP
            GeneID:4824 -> Biological process: GO:0045893 [positive regulation of transcription, DNA-dependent] evidence: IMP
            GeneID:4824 -> Biological process: GO:0045893 [positive regulation of transcription, DNA-dependent] evidence: ISS
            GeneID:4824 -> Biological process: GO:0045930 [negative regulation of mitotic cell cycle] evidence: IDA
            GeneID:4824 -> Biological process: GO:0045931 [positive regulation of mitotic cell cycle] evidence: IMP
            GeneID:4824 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IDA
            GeneID:4824 -> Biological process: GO:0048754 [branching morphogenesis of an epithelial tube] evidence: ISS
            GeneID:4824 -> Biological process: GO:0050680 [negative regulation of epithelial cell proliferation] evidence: ISS
            GeneID:4824 -> Biological process: GO:0051781 [positive regulation of cell division] evidence: IMP
            GeneID:4824 -> Biological process: GO:0060037 [pharyngeal system development] evidence: IEA
            GeneID:4824 -> Biological process: GO:0060442 [branching involved in prostate gland morphogenesis] evidence: ISS
            GeneID:4824 -> Biological process: GO:0060664 [epithelial cell proliferation involved in salivary gland morphogenesis] evidence: ISS
            GeneID:4824 -> Biological process: GO:0060770 [negative regulation of epithelial cell proliferation involved in prostate gland development] evidence: ISS
            GeneID:4824 -> Biological process: GO:0071347 [cellular response to interleukin-1] evidence: IEP
            GeneID:4824 -> Biological process: GO:0071356 [cellular response to tumor necrosis factor] evidence: IEP
            GeneID:4824 -> Biological process: GO:0071383 [cellular response to steroid hormone stimulus] evidence: IDA
            GeneID:4824 -> Biological process: GO:0071456 [cellular response to hypoxia] evidence: IDA
            GeneID:4824 -> Biological process: GO:0071850 [mitotic cell cycle arrest] evidence: IDA
            GeneID:4824 -> Biological process: GO:0071899 [negative regulation of estrogen receptor binding] evidence: IDA
            GeneID:4824 -> Biological process: GO:2000836 [positive regulation of androgen secretion] evidence: IDA
            GeneID:4824 -> Biological process: GO:2001022 [positive regulation of response to DNA damage stimulus] evidence: IDA
            GeneID:4824 -> Biological process: GO:2001235 [positive regulation of apoptotic signaling pathway] evidence: IDA
            GeneID:4824 -> Biological process: GO:2001244 [positive regulation of intrinsic apoptotic signaling pathway] evidence: IDA
            GeneID:4824 -> Cellular component: GO:0005622 [intracellular] evidence: IDA
            GeneID:4824 -> Cellular component: GO:0005634 [nucleus] evidence: IC
            GeneID:4824 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
            GeneID:4824 -> Cellular component: GO:0005634 [nucleus] evidence: NAS