GGRNA Home | Help | Advanced search

2025-06-19 09:25:06, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_005853               2078 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens iroquois homeobox 5 (IRX5), transcript variant 1,
            mRNA.
ACCESSION   NM_005853 XM_001129953
VERSION     NM_005853.5  GI:139394645
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2078)
  AUTHORS   Bonnard,C., Strobl,A.C., Shboul,M., Lee,H., Merriman,B.,
            Nelson,S.F., Ababneh,O.H., Uz,E., Guran,T., Kayserili,H., Hamamy,H.
            and Reversade,B.
  TITLE     Mutations in IRX5 impair craniofacial development and germ cell
            migration via SDF1
  JOURNAL   Nat. Genet. 44 (6), 709-713 (2012)
   PUBMED   22581230
  REMARK    GeneRIF: Our findings suggest that IRX proteins integrate
            combinatorial transcriptional inputs to regulate key signaling
            molecules involved in the ontogeny of multiple organs during
            embryogenesis and homeostasis.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2078)
  AUTHORS   Murea,M., Lu,L., Ma,L., Hicks,P.J., Divers,J., McDonough,C.W.,
            Langefeld,C.D., Bowden,D.W. and Freedman,B.I.
  TITLE     Genome-wide association scan for survival on dialysis in
            African-Americans with type 2 diabetes
  JOURNAL   Am. J. Nephrol. 33 (6), 502-509 (2011)
   PUBMED   21546767
REFERENCE   3  (bases 1 to 2078)
  AUTHORS   Myrthue,A., Rademacher,B.L., Pittsenbarger,J., Kutyba-Brooks,B.,
            Gantner,M., Qian,D.Z. and Beer,T.M.
  TITLE     The iroquois homeobox gene 5 is regulated by 1,25-dihydroxyvitamin
            D3 in human prostate cancer and regulates apoptosis and the cell
            cycle in LNCaP prostate cancer cells
  JOURNAL   Clin. Cancer Res. 14 (11), 3562-3570 (2008)
   PUBMED   18519790
  REMARK    GeneRIF: Irx5 is involved in the regulation of both the cell cycle
            and apoptosis in human prostate cancer cells
REFERENCE   4  (bases 1 to 2078)
  AUTHORS   Bruneau,B.G.
  TITLE     [Irx5: a transcription factor that regulates the cardiac
            repolarization gradient]
  JOURNAL   Med Sci (Paris) 22 (3), 231-232 (2006)
   PUBMED   16527195
  REMARK    GeneRIF: involved in transcriptional regulation of heart
            morphogenesis
REFERENCE   5  (bases 1 to 2078)
  AUTHORS   Ogura,K., Matsumoto,K., Kuroiwa,A., Isobe,T., Otoguro,T.,
            Jurecic,V., Baldini,A., Matsuda,Y. and Ogura,T.
  TITLE     Cloning and chromosome mapping of human and chicken Iroquois (IRX)
            genes
  JOURNAL   Cytogenet. Cell Genet. 92 (3-4), 320-325 (2001)
   PUBMED   11435706
REFERENCE   6  (bases 1 to 2078)
  AUTHORS   Lewis,M.T., Ross,S., Strickland,P.A., Snyder,C.J. and Daniel,C.W.
  TITLE     Regulated expression patterns of IRX-2, an Iroquois-class homeobox
            gene, in the human breast
  JOURNAL   Cell Tissue Res. 296 (3), 549-554 (1999)
   PUBMED   10370142
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AY335945.1 and BC074850.2.
            This sequence is a reference standard in the RefSeqGene project.
            On Apr 3, 2007 this sequence version replaced gi:47778932.
            
            Summary: This gene encodes a member of the iroquois homeobox gene
            family, which are involved in several embryonic developmental
            processes. Knockout mice lacking this gene show that it is required
            for retinal cone bipolar cell differentiation, and that it
            negatively regulates potassium channel gene expression in the heart
            to ensure coordinated cardiac repolarization. Alternatively spliced
            transcript variants encoding different isoforms have been found for
            this gene. [provided by RefSeq, Nov 2011].
            
            Transcript Variant: This variant (1) encodes the longer isoform
            (1).
            
            ##Evidence-Data-START##
            Transcript exon combination :: AI814659.1, AI338253.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025083, ERS025087 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-655               AY335945.1         1-655
            656-1482            BC074850.2         485-1311
            1483-2078           AY335945.1         1480-2075
FEATURES             Location/Qualifiers
     source          1..2078
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="16"
                     /map="16q12.2"
     gene            1..2078
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /note="iroquois homeobox 5"
                     /db_xref="GeneID:10265"
                     /db_xref="HGNC:14361"
                     /db_xref="MIM:606195"
     STS             1..1539
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /db_xref="UniSTS:486427"
     CDS             1..1452
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /note="isoform 1 is encoded by transcript variant 1;
                     iroquois-class homeodomain protein IRX-5; homeodomain
                     protein IRXB2; homeodomain protein IRX-2A"
                     /codon_start=1
                     /product="iroquois-class homeodomain protein IRX-5 isoform
                     1"
                     /protein_id="NP_005844.4"
                     /db_xref="GI:139394646"
                     /db_xref="CCDS:CCDS10751.1"
                     /db_xref="GeneID:10265"
                     /db_xref="HGNC:14361"
                     /db_xref="MIM:606195"
                     /translation="
MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPGYNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWTPRNRSEDEEEEENIDLEKNDEDEPQKPEDKGDPEGPEAGGAEQKAASGCERLQGPPTPAGKETEGSLSDSDFKEPPSEGRLDALQGPPRTGGPSPAGPAAARLAEDPAPHYPAGAPAPGPHPAAGEVPPGPGGPSVIHSPPPPPPPAVLAKPKLWSLAEIATSSDKVKDGGGGNEGSPCPPCPGPIAGQALGGSRASPAPAPSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNYGSFGHLHGHPGPGPGPTTGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPYELKKGMSDI
"
     misc_feature    349..525
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(349..354,358..360,418..420,436..438,475..477,
                     481..486,493..498,502..510,514..519)
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(355..357,484..486,493..498,505..507)
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     exon            1..249
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /inference="alignment:Splign:1.39.8"
     variation       25
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:13336969"
     variation       61
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373958797"
     variation       100
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377035980"
     variation       128
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200623174"
     exon            250..655
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /inference="alignment:Splign:1.39.8"
     variation       258
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:367957249"
     variation       324
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374150005"
     variation       357
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151037166"
     variation       375
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377509714"
     STS             396..460
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /standard_name="Irx3"
                     /db_xref="UniSTS:498475"
     variation       402
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141819678"
     variation       448
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:387907198"
     variation       471
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201130194"
     variation       510
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370696419"
     variation       567
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150223604"
     variation       646
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373164018"
     exon            656..2064
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /inference="alignment:Splign:1.39.8"
     variation       681
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139113918"
     variation       689
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:377050650"
     variation       691
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200111411"
     variation       707
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:115549200"
     variation       713
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374666773"
     variation       716
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199865474"
     variation       717
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369095091"
     variation       763
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:13336114"
     variation       778
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199861709"
     variation       876
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:7188328"
     variation       1092
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375662858"
     variation       1101
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201738191"
     variation       1116
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370016055"
     variation       1135
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201360101"
     variation       1141
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377649301"
     variation       1145
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202086902"
     variation       1156
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375313978"
     variation       1164
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:377595777"
     variation       1183
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370331090"
     variation       1232
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200394212"
     variation       1254
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373826345"
     variation       1265
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143660069"
     variation       1292
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368818152"
     variation       1381
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201200647"
     variation       1394
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147189488"
     variation       1421
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200920393"
     variation       1465
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202087837"
     variation       1482
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:181048280"
     variation       1525..1528
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace=""
                     /replace="gaga"
                     /db_xref="dbSNP:375453518"
     variation       1577
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183727841"
     variation       1617
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:189712212"
     variation       1623
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:375093347"
     variation       1624
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:7190373"
     variation       1625..1627
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="aaa"
                     /replace="cac"
                     /db_xref="dbSNP:367688412"
     variation       1625
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:113225061"
     variation       1626
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1133610"
     variation       1641
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371830279"
     variation       1682
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141076276"
     variation       1704..1708
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace=""
                     /replace="gcatt"
                     /db_xref="dbSNP:71865827"
     variation       1807
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374076585"
     variation       1839
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:181183549"
     variation       1906
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1133611"
     variation       1995
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186840955"
     polyA_signal    2037..2042
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
     variation       2061
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:192716743"
     polyA_site      2064
                     /gene="IRX5"
                     /gene_synonym="HMMS; IRX-2a; IRXB2"
ORIGIN      
atgtcctatccgcagggctacttgtaccagccgtccgcctcgctggcgctctactcgtgcccggcgtacagcaccagcgtcatttcggggccccgcacggatgagctcggccgctcttcttcgggctccgcgttctcgccctacgctggctcgactgccttcacggcgccctcgccgggctacaactcgcacctccagtacggcgccgaccccgcggccgccgccgccgccgccttctcctcgtacgtgggctctccctacgaccacacacccggcatggcgggctccttggggtaccatccttacgcggcgcccctgggatcgtacccttacggggacccagcgtaccggaagaacgccacaagggacgccacggctaccctcaaggcctggctcaacgagcaccgcaagaacccctaccccaccaagggcgagaagatcatgctggccatcatcaccaagatgaccctcacccaggtgtccacctggttcgccaacgcgcgccggcgcctcaagaaagagaataaaatgacgtggacgccgcggaaccgcagcgaggacgaggaagaggaggagaacattgacctggagaagaacgacgaggacgagccccagaagcccgaggacaagggcgaccccgagggccccgaagcaggaggagctgagcagaaggcggcttcgggctgcgaacggcttcagggaccacccacccctgcaggcaaggagacggagggcagcctcagcgactcggattttaaggagccgccctcggagggccgcctcgacgcgctgcagggccccccccgcaccggcgggccctccccggctgggccagcggcggcgcggctggcggaggacccggcccctcactaccccgccggagcgccggcgcccggcccgcatccagccgcgggcgaggtgcctccgggtcccggcgggccctcggttatccattcgccgcctccgccgccgcctcctgcggtgctcgccaagcccaaactgtggtctttggcagagatcgccacatcgtcggacaaggtcaaggacgggggcggcgggaacgagggctctccatgcccaccgtgtcccgggcccatagccgggcaagccctaggaggcagccgggcgtcgccggccccggcgccgtcacgctcgccctcggcgcagtgtccttttccaggcgggacggtgctgtcccggcctctctactacaccgcgcccttctatcccggctacacgaactatggctccttcggacaccttcatggccacccggggcccgggccaggccccacaaccggtccggggtctcatttcaatggattaaaccagaccgtgttgaaccgagcggacgctttggctaaagacccgaaaatgttgcggagccagtctcagctagacctgtgcaaagactctccctatgaattgaagaaaggtatgtccgacatttaacgcgggctgcgtcggtcccggacttttctaatttattaaaaacatggccttggcagttatttttccatcaccgagagagagagacagagagagaaaataaactacccctcctattcagaagtttatagtttatggagatggatgacataaaaatgtaaacatctccacacaaaaaaaaaaatgtcttaaccaaccgaaaagaaaaattaaaaaaggatttgtattaaatcttattctgtatatttaatgtagcatttttgtatttaaattgataattcaatatctttgaagtaaattatgaaatcaagacacctgtacaggcatttaatgtttttttgtaatataaatatatacatttgtgtttcccccaaaactgtttcatagttaaaaaatacaagtttaatttaattttttacacctattgattctgctgggtatgagctaaagtattacagaaaggaaacaggttatactcttagatttaaaaagtgaaagaaactgcaggcgcctttgtaaaatgcaaaatatttaattaaaagagattttaacataatgagagccactcattactttttagaagcctcaataaactgtccattgccttggtcaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:10265 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:10265 -> Molecular function: GO:0005499 [vitamin D binding] evidence: IEA
            GeneID:10265 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:10265 -> Biological process: GO:0002027 [regulation of heart rate] evidence: IEA
            GeneID:10265 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
            GeneID:10265 -> Biological process: GO:0007601 [visual perception] evidence: IEA
            GeneID:10265 -> Biological process: GO:0008406 [gonad development] evidence: IMP
            GeneID:10265 -> Biological process: GO:0042551 [neuron maturation] evidence: IEA
            GeneID:10265 -> Biological process: GO:0048701 [embryonic cranial skeleton morphogenesis] evidence: IMP
            GeneID:10265 -> Biological process: GO:0050896 [response to stimulus] evidence: IEA
            GeneID:10265 -> Biological process: GO:0060040 [retinal bipolar neuron differentiation] evidence: IEA
            GeneID:10265 -> Cellular component: GO:0005634 [nucleus] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.