LOCUS       NM_005568               3431 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens LIM homeobox 1 (LHX1), mRNA.
ACCESSION   NM_005568
VERSION     NM_005568.3  GI:314122156
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3431)
  AUTHORS   Mumert,M., Dubuc,A., Wu,X., Northcott,P.A., Chin,S.S., Pedone,C.A.,
            Taylor,M.D. and Fults,D.W.
  TITLE     Functional genomics identifies drivers of medulloblastoma
            dissemination
  JOURNAL   Cancer Res. 72 (19), 4944-4953 (2012)
   PUBMED   22875024
  REMARK    GeneRIF: Data indicate that expression of ERAS, LHX1, and CCRK is
            increased in aggressive subgroups of medulloblastomas.
REFERENCE   2  (bases 1 to 3431)
  AUTHORS   Ledig,S., Brucker,S., Barresi,G., Schomburg,J., Rall,K. and
            Wieacker,P.
  TITLE     Frame shift mutation of LHX1 is associated with
            Mayer-Rokitansky-Kuster-Hauser (MRKH) syndrome
  JOURNAL   Hum. Reprod. 27 (9), 2872-2875 (2012)
   PUBMED   22740494
  REMARK    GeneRIF: study concludes that heterozygous mutations of LHX1 might
            be one cause of the Mayer-Rokitansky-Kuster-Hauser syndrome in a
            subgroup of patients
REFERENCE   3  (bases 1 to 3431)
  AUTHORS   Ye,L., Evans,J. and Gargett,C.E.
  TITLE     Lim1/LIM1 is expressed in developing and adult mouse and human
            endometrium
  JOURNAL   Histochem. Cell Biol. 137 (4), 527-536 (2012)
   PUBMED   22231913
  REMARK    GeneRIF: Lim1/LIM1 expression in neonatal, adult mouse and human
            endometrium suggesting Lim1/LIM1 may have a role in endometrial
            development and remodelling
REFERENCE   4  (bases 1 to 3431)
  AUTHORS   Xia,M., Zhao,H., Qin,Y., Mu,Y., Wang,J., Bian,Y., Ma,J. and
            Chen,Z.J.
  TITLE     LHX1 mutation screening in 96 patients with mullerian duct
            abnormalities
  JOURNAL   Fertil. Steril. 97 (3), 682-685 (2012)
   PUBMED   22217964
  REMARK    GeneRIF: Mutations in the coding regions of LHX1 may not be a
            common genetic etiologic factor involved in Han Chinese patients
            with mullerian duct abnormalities.
REFERENCE   5  (bases 1 to 3431)
  AUTHORS   Guertl,B., Senanayake,U., Nusshold,E., Leuschner,I., Mannweiler,S.,
            Ebner,B. and Hoefler,G.
  TITLE     Lim1, an embryonal transcription factor, is absent in multicystic
            renal dysplasia, but reactivated in nephroblastomas
  JOURNAL   Pathobiology 78 (4), 210-219 (2011)
   PUBMED   21778788
  REMARK    GeneRIF: Eleven dysplastic kidneys showed no expression of LIM1. In
            contrast, 12 of 32 nephroblastomas showed nuclear positivity.
REFERENCE   6  (bases 1 to 3431)
  AUTHORS   Phillips,J.C.
  TITLE     Assignment of LHX1 to human chromosome bands 17q11.2-->q12 by use
            of radiation hybrid mapping and somatic cell hybridization
  JOURNAL   Cytogenet. Genome Res. 97 (1-2), 140D (2002)
   PUBMED   12438757
REFERENCE   7  (bases 1 to 3431)
  AUTHORS   Lim,H.N. and Hawkins,J.R.
  TITLE     Genetic control of gonadal differentiation
  JOURNAL   Baillieres Clin. Endocrinol. Metab. 12 (1), 1-16 (1998)
   PUBMED   9890059
  REMARK    Review article
REFERENCE   8  (bases 1 to 3431)
  AUTHORS   Jurata,L.W., Pfaff,S.L. and Gill,G.N.
  TITLE     The nuclear LIM domain interactor NLI mediates homo- and
            heterodimerization of LIM domain transcription factors
  JOURNAL   J. Biol. Chem. 273 (6), 3152-3157 (1998)
   PUBMED   9452425
REFERENCE   9  (bases 1 to 3431)
  AUTHORS   Dong,W.F., Heng,H.H., Lowsky,R., Xu,Y., DeCoteau,J.F., Shi,X.M.,
            Tsui,L.C. and Minden,M.D.
  TITLE     Cloning, expression, and chromosomal localization to 11p12-13 of a
            human LIM/HOMEOBOX gene, hLim-1
  JOURNAL   DNA Cell Biol. 16 (6), 671-678 (1997)
   PUBMED   9212161
REFERENCE   10 (bases 1 to 3431)
  AUTHORS   Bozzi,F., Bertuzzi,S., Strina,D., Giannetto,C., Vezzoni,P. and
            Villa,A.
  TITLE     The exon-intron structure of human LHX1 gene
  JOURNAL   Biochem. Biophys. Res. Commun. 229 (2), 494-497 (1996)
   PUBMED   8954926
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC020470.1, BC101674.1 and
            AC023315.4.
            On Dec 11, 2010 this sequence version replaced gi:30410784.
            
            Summary: This gene encodes a member of a large protein family which
            contains the LIM domain, a unique cysteine-rich zinc-binding
            domain. The encoded protein is a transcription factor important for
            the development of the renal and urogenital systems. This gene is a
            candidate for Mayer-Rokitansky-Kuster-Hauser syndrome, a disorder
            characterized by anomalies in the female genital tract. [provided
            by RefSeq, Dec 2010].
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U14755.1, BC101674.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025086 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-631               BC020470.1         1-631
            632-1973            BC101674.1         1-1342
            1974-3431           AC023315.4         90381-91838         c
FEATURES             Location/Qualifiers
     source          1..3431
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17q12"
     gene            1..3431
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /note="LIM homeobox 1"
                     /db_xref="GeneID:3975"
                     /db_xref="HGNC:6593"
                     /db_xref="HPRD:09067"
                     /db_xref="MIM:601999"
     exon            1..893
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /inference="alignment:Splign:1.39.8"
     variation       105
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:192905708"
     variation       112
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:184511261"
     variation       339..340
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:34753569"
     variation       341
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367563768"
     variation       372
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376505768"
     variation       385
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371627466"
     variation       459
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111599710"
     variation       505
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75587965"
     misc_feature    520..522
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /note="upstream in-frame stop codon"
     variation       533
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:71380120"
     variation       536
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115972448"
     variation       631
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147921409"
     STS             632..1973
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /db_xref="UniSTS:484349"
     variation       685..686
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:147798700"
     variation       689
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182011601"
     variation       695
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373965589"
     variation       697
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376080106"
     variation       700
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200836692"
     CDS             724..1944
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /note="LIM homeobox protein 1; homeobox protein Lim-1"
                     /codon_start=1
                     /product="LIM/homeobox protein Lhx1"
                     /protein_id="NP_005559.2"
                     /db_xref="GI:30410785"
                     /db_xref="CCDS:CCDS11316.1"
                     /db_xref="GeneID:3975"
                     /db_xref="HGNC:6593"
                     /db_xref="HPRD:09067"
                     /db_xref="MIM:601999"
                     /translation="

MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLSNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEAGSNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYGDYQSEYYGPGGNYDFFPQGPPSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEMNEAAVW

"
     misc_feature    733..888
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /note="The first LIM domain of Lhx1 (also known as Lim1)
                     and Lhx5; Region: LIM1_Lhx1_Lhx5; cd09367"
                     /db_xref="CDD:188753"
     misc_feature    order(733..735,742..744,796..798,805..807,814..816,
                     823..825,874..876,883..885)
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188753"
     misc_feature    910..1077
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /note="The second LIM domain of Lhx1 (also known as Lim1)
                     and Lhx5; Region: LIM2_Lhx1_Lhx5; cd09375"
                     /db_xref="CDD:188761"
     misc_feature    order(910..912,919..921,976..978,985..987,994..996,
                     1003..1005,1063..1065,1072..1074)
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188761"
     misc_feature    1264..1440
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(1264..1278,1282..1284,1333..1335,1351..1353,
                     1390..1392,1396..1401,1408..1413,1417..1425,1429..1434)
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(1270..1272,1279..1281,1399..1401,1408..1413,
                     1420..1422)
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     variation       738
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:142631346"
     variation       783
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375599044"
     variation       882
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:34167802"
     variation       892
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:35618899"
     exon            894..1120
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /inference="alignment:Splign:1.39.8"
     variation       894
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199890217"
     variation       935
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202067640"
     variation       952
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181308670"
     variation       1014
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:28417559"
     variation       1080
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:144856321"
     variation       1084
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200877362"
     variation       1107
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141677146"
     exon            1121..1398
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /inference="alignment:Splign:1.39.8"
     variation       1128
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111571482"
     variation       1139
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:77646323"
     variation       1170
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:149879844"
     variation       1179
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138383061"
     variation       1221
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371390635"
     variation       1240
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201521937"
     variation       1261
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:77511066"
     variation       1263
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374547056"
     variation       1324
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143849657"
     variation       1335
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200637129"
     variation       1339
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201087752"
     variation       1344
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377505639"
     variation       1355
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112680588"
     exon            1399..1564
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /inference="alignment:Splign:1.39.8"
     variation       1449
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374154007"
     variation       1452
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371008313"
     variation       1513
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375450593"
     variation       1539
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199823149"
     variation       1540
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368764737"
     variation       1541
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371297528"
     exon            1565..3431
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /inference="alignment:Splign:1.39.8"
     variation       1587
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:372137646"
     variation       1614
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375453089"
     variation       1625
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:148800710"
     variation       1632
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144896333"
     variation       1643
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147937067"
     variation       1668
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112081488"
     variation       1688
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199559106"
     variation       1692
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:369853713"
     variation       1704
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372094506"
     variation       1718
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:377221498"
     variation       1738
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376663056"
     variation       1743
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201825686"
     STS             1748..1874
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /standard_name="RH71201"
                     /db_xref="UniSTS:55795"
     variation       1797
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145489633"
     variation       1809
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151062337"
     variation       1821
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:75973369"
     variation       1834
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150197430"
     variation       1862
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369179293"
     variation       1863
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:182084469"
     variation       1872
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373405460"
     variation       1885
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:145694637"
     variation       1898
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141144953"
     variation       1911
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376578880"
     variation       1920
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371131038"
     variation       1938
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368870359"
     variation       1959
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371586697"
     variation       1981
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376713297"
     variation       1991
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374400056"
     variation       2010
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace=""
                     /replace="tag"
                     /db_xref="dbSNP:71693251"
     variation       2011..2012
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace=""
                     /replace="aa"
                     /db_xref="dbSNP:138151008"
     variation       2011..2012
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace=""
                     /replace="aaaa"
                     /db_xref="dbSNP:372092253"
     variation       2011
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:369876115"
     variation       2011
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace=""
                     /replace="aaa"
                     /db_xref="dbSNP:368565148"
     variation       2012
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:35033250"
     variation       2106
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:186284263"
     variation       2112
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376915562"
     variation       2137
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:111387196"
     variation       2245..2246
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:34300620"
     variation       2294
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190703415"
     variation       2323
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:369194373"
     variation       2352
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373238595"
     variation       2377
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139582613"
     variation       2474
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:78438539"
     variation       2498
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76334395"
     variation       2667
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73985312"
     variation       2729
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142874133"
     variation       2748
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:35240464"
     variation       2748
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace=""
                     /replace="aa"
                     /db_xref="dbSNP:372408333"
     variation       2763
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace=""
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:71159670"
     variation       2771
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73283924"
     variation       2801
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183046968"
     variation       2924
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:150608271"
     variation       3061
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:188619158"
     variation       3080..3081
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:34618208"
     variation       3081
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace=""
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:57497669"
     variation       3097..3098
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace=""
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:57072955"
     variation       3228
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:192772815"
     variation       3256
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:113147497"
     variation       3388
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:377105610"
     polyA_signal    3403..3408
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
     polyA_site      3428
                     /gene="LHX1"
                     /gene_synonym="LIM-1; LIM1"
ORIGIN      

ccaagatcttcctcctaccctcccctctttcccttctcccgcggtcggccctcgccccctcccccaggcccagcgcgggcgctcggcgcgtccagacccgcggcgcgatgccggcagtttaggatccaaagcttctctgctccttttgttctttccttcccttttttaaaaaaagaggggggaaatcccagtggtgggcagcctggcacgcacacagtcgccctcataccccgacaaaagcagatgcactttgacttctgacagctctacctcaagccccggagaactcagcggcgctttcctcgcaacccgagctcggcgagtcgtcgtcttcttcttctccgtttttatttatttatttccgttcccgccgccgttctcgctgaccttcactcctccgcgggctctgagcagaagggtcgcattctctcccgcctgagacttcttttcctcgccccgggagctcaggcggcgccgctccagcccggggccccgggactccccggctgcacacttcactgagacgcccccccaggccccgatcagcctcgtttcctccaccctactttgatttcctggtgcgagttttggcttgcacggccgagtgtgtgtcctctttttggagagactggggagctcgtgccgattgtcttcaggagtcatcccctgggctctactttgcccctctctctctctgggcctcatcagaccaaaccaaagaccatggttcactgtgccggctgcaaaaggcccatcctggaccgctttctcttgaacgtgctggacagggcctggcacgtcaagtgcgtccagtgctgtgaatgtaaatgcaacctgaccgagaagtgcttctccagggaaggcaaactctactgcaagaacgacttcttccggtgtttcggtaccaaatgcgcaggctgcgctcagggcatctcccctagcgacctggtgcggagagcgcggagcaaagtgtttcacctgaactgcttcacctgcatgatgtgtaacaagcagctctccactggcgaggaactctacatcatcgacgagaataagttcgtctgcaaagaggattacctaagtaacagcagtgttgccaaagagaacagccttcactcggccaccacgggcagtgaccccagtttgtctccggattcccaagacccgtcgcaggacgacgccaaggactcggagagcgccaacgtgtcggacaaggaagcgggtagcaacgagaatgacgaccagaacctgggcgccaagcggcggggaccgcgcaccaccatcaaagccaagcagctggagacgctgaaggccgccttcgctgctacacccaagcccacccgccacatccgcgagcagctggcgcaggagaccggcctcaacatgcgcgtcattcaggtctggttccagaaccggcgctccaaggagcggaggatgaagcagctgagcgccctgggcgcccggcgccacgccttcttccgcagtccgcgccggatgcggccgctggtggaccgcctggagccgggcgagctcatccccaatggtcccttctccttctacggagattaccagagcgagtactacgggcccgggggcaactacgacttcttcccgcaaggccccccgtcctcgcaggcccagacaccagtggacctacccttcgtgccgtcatctgggccgtccgggacgcccctgggtggcctggagcacccgctgccgggccaccacccgtcgagcgaggcgcagcggtttaccgacatcctggcgcacccacccggggactcgcccagccccgagcccagcctgcccgggcctctgcactccatgtcggccgaggtcttcggacccagcccgcccttctcgtcgctgtcggtcaacggtggggcgagctacggaaaccacctgtcccacccccccgaaatgaacgaggcggccgtgtggtagcggggtctcgcacggtctgcggagttcgtggttgtacagaaatgaacctttatttaagaaaaatagaaaaaaaaaaaaacataaaaagcaagtccccacccccttcctccagcctcgagaaccattctccttctggggagaccggatggaaaagggggacacgaaataggatccaaatcggcctcgaggtgggactgggatccgcgcactggctgtcgacgtgcagaactggggctccccaaaggaaacgcagacctctccccaactcccacctggacccggatccgtagacagaccccgcgggcgtgtgcgcctggcaggcgggcggcgaaaagacgtccagggcagccgcgggtgcgcacagccgttggcgatgccaggagccgtggggagggaggccgtgagcacagccgggtgaaggaagtgaagcggcccagggcgctcccgggccagccaggagggttctagctctgggatatcccttattagtgttgtctcagagttcaacaacagcgacaaaaaactcttatagcttcagaaacgccgacctgccgtgcatcaggtgggactatatatatattttttgtctatctggatttttggtttttgtttttgccaaaattgcaaaattctaaatgtaaagccctccgtatcaactcttctaccttcgcaaaactacacatacacacatacacacgtacacggacacactcggtaagatggtctccagccagaccgctcagtaaaatgacttgaacatcagctgtacaagaaaagtattctaccttcacacacaaaaagttaaaaaaaaaaaaaaaagactattgaactaaaaacagtcaactgtttacgtataatgttaaattcaggagttcagtgttttactaatatatcctgttttgaaacctcttgttcgaaaacaaaatgttttgagcaatcaaccaaaattgttccttttcttttcctgtagatgttctgacagatttgcagggctttcggctcactgtgctagtatgtaaaaaggtgttgtttacacgaggcaaagagaaaacatgctattcagacagttgccaaatagaataattatagcacaaatactgtaaaggtgcctggcaccagcaacctgagaaagtgttaaaaaaaaaaaaaaaaaagtgttacaagatttaaaaaaaaacatctttgctaatttttttgtcctgttgaacattcatggaattgttaatatgacttatatagacccacacaggttttatttttgtgtctttaaaataaaagtccaaaatatttaaattttatggtcaaatatgcagtcaacagctgctactttttctttatatattaaatttctcatatgtcttttattgttctaataaacctaagcttgtgtgacctccagtgcatattagaccattcactgtatgaaagaaaacatgttgaataaatttgtgagtttttaataaaaatagaaaatctgatgtttagat

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:3975 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: ISS
            GeneID:3975 -> Molecular function: GO:0003714 [transcription corepressor activity] evidence: ISS
            GeneID:3975 -> Molecular function: GO:0008270 [zinc ion binding] evidence: IEA
            GeneID:3975 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:3975 -> Biological process: GO:0001655 [urogenital system development] evidence: ISS
            GeneID:3975 -> Biological process: GO:0001657 [ureteric bud development] evidence: ISS
            GeneID:3975 -> Biological process: GO:0001658 [branching involved in ureteric bud morphogenesis] evidence: IEA
            GeneID:3975 -> Biological process: GO:0001702 [gastrulation with mouth forming second] evidence: ISS
            GeneID:3975 -> Biological process: GO:0001705 [ectoderm formation] evidence: ISS
            GeneID:3975 -> Biological process: GO:0001706 [endoderm formation] evidence: ISS
            GeneID:3975 -> Biological process: GO:0001822 [kidney development] evidence: ISS
            GeneID:3975 -> Biological process: GO:0006366 [transcription from RNA polymerase II promoter] evidence: ISS
            GeneID:3975 -> Biological process: GO:0007267 [cell-cell signaling] evidence: ISS
            GeneID:3975 -> Biological process: GO:0007389 [pattern specification process] evidence: ISS
            GeneID:3975 -> Biological process: GO:0007399 [nervous system development] evidence: TAS
            GeneID:3975 -> Biological process: GO:0008045 [motor neuron axon guidance] evidence: ISS
            GeneID:3975 -> Biological process: GO:0009653 [anatomical structure morphogenesis] evidence: ISS
            GeneID:3975 -> Biological process: GO:0009791 [post-embryonic development] evidence: ISS
            GeneID:3975 -> Biological process: GO:0009880 [embryonic pattern specification] evidence: ISS
            GeneID:3975 -> Biological process: GO:0009887 [organ morphogenesis] evidence: TAS
            GeneID:3975 -> Biological process: GO:0009948 [anterior/posterior axis specification] evidence: ISS
            GeneID:3975 -> Biological process: GO:0009952 [anterior/posterior pattern specification] evidence: ISS
            GeneID:3975 -> Biological process: GO:0009953 [dorsal/ventral pattern formation] evidence: ISS
            GeneID:3975 -> Biological process: GO:0010468 [regulation of gene expression] evidence: ISS
            GeneID:3975 -> Biological process: GO:0010842 [retina layer formation] evidence: ISS
            GeneID:3975 -> Biological process: GO:0021517 [ventral spinal cord development] evidence: IEA
            GeneID:3975 -> Biological process: GO:0021527 [spinal cord association neuron differentiation] evidence: ISS
            GeneID:3975 -> Biological process: GO:0021537 [telencephalon development] evidence: IEA
            GeneID:3975 -> Biological process: GO:0021549 [cerebellum development] evidence: ISS
            GeneID:3975 -> Biological process: GO:0021702 [cerebellar Purkinje cell differentiation] evidence: ISS
            GeneID:3975 -> Biological process: GO:0021871 [forebrain regionalization] evidence: ISS
            GeneID:3975 -> Biological process: GO:0021937 [cerebellar Purkinje cell-granule cell precursor cell signaling involved in regulation of granule cell precursor cell proliferation] evidence: ISS
            GeneID:3975 -> Biological process: GO:0032525 [somite rostral/caudal axis specification] evidence: IEA
            GeneID:3975 -> Biological process: GO:0035502 [metanephric part of ureteric bud development] evidence: IEA
            GeneID:3975 -> Biological process: GO:0035846 [oviduct epithelium development] evidence: ISS
            GeneID:3975 -> Biological process: GO:0035847 [uterine epithelium development] evidence: ISS
            GeneID:3975 -> Biological process: GO:0035849 [nephric duct elongation] evidence: IEA
            GeneID:3975 -> Biological process: GO:0035852 [horizontal cell localization] evidence: IEA
            GeneID:3975 -> Biological process: GO:0040019 [positive regulation of embryonic development] evidence: ISS
            GeneID:3975 -> Biological process: GO:0044344 [cellular response to fibroblast growth factor stimulus] evidence: IEA
            GeneID:3975 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: ISS
            GeneID:3975 -> Biological process: GO:0045893 [positive regulation of transcription, DNA-dependent] evidence: ISS
            GeneID:3975 -> Biological process: GO:0048646 [anatomical structure formation involved in morphogenesis] evidence: ISS
            GeneID:3975 -> Biological process: GO:0048703 [embryonic viscerocranium morphogenesis] evidence: ISS
            GeneID:3975 -> Biological process: GO:0048793 [pronephros development] evidence: IEA
            GeneID:3975 -> Biological process: GO:0060059 [embryonic retina morphogenesis in camera-type eye] evidence: ISS
            GeneID:3975 -> Biological process: GO:0060065 [uterus development] evidence: ISS
            GeneID:3975 -> Biological process: GO:0060066 [oviduct development] evidence: ISS
            GeneID:3975 -> Biological process: GO:0060067 [cervix development] evidence: ISS
            GeneID:3975 -> Biological process: GO:0060068 [vagina development] evidence: ISS
            GeneID:3975 -> Biological process: GO:0060322 [head development] evidence: ISS
            GeneID:3975 -> Biological process: GO:0060429 [epithelium development] evidence: ISS
            GeneID:3975 -> Biological process: GO:0061205 [paramesonephric duct development] evidence: ISS
            GeneID:3975 -> Biological process: GO:0072049 [comma-shaped body morphogenesis] evidence: ISS
            GeneID:3975 -> Biological process: GO:0072050 [S-shaped body morphogenesis] evidence: ISS
            GeneID:3975 -> Biological process: GO:0072077 [renal vesicle morphogenesis] evidence: ISS
            GeneID:3975 -> Biological process: GO:0072177 [mesonephric duct development] evidence: IEA
            GeneID:3975 -> Biological process: GO:0072178 [nephric duct morphogenesis] evidence: ISS
            GeneID:3975 -> Biological process: GO:0072224 [metanephric glomerulus development] evidence: IEA
            GeneID:3975 -> Biological process: GO:0072278 [metanephric comma-shaped body morphogenesis] evidence: IEA
            GeneID:3975 -> Biological process: GO:0072283 [metanephric renal vesicle morphogenesis] evidence: IEA
            GeneID:3975 -> Biological process: GO:0072284 [metanephric S-shaped body morphogenesis] evidence: IEA
            GeneID:3975 -> Biological process: GO:0090009 [primitive streak formation] evidence: ISS
            GeneID:3975 -> Biological process: GO:0090190 [positive regulation of branching involved in ureteric bud morphogenesis] evidence: ISS
            GeneID:3975 -> Biological process: GO:0097477 [lateral motor column neuron migration] evidence: ISS
            GeneID:3975 -> Biological process: GO:2000543 [positive regulation of gastrulation] evidence: ISS
            GeneID:3975 -> Biological process: GO:2000744 [positive regulation of anterior head development] evidence: ISS
            GeneID:3975 -> Biological process: GO:2000768 [positive regulation of nephron tubule epithelial cell differentiation] evidence: ISS
            GeneID:3975 -> Cellular component: GO:0005634 [nucleus] evidence: ISS
            GeneID:3975 -> Cellular component: GO:0043234 [protein complex] evidence: ISS